OCR | |
 | [...]ba The Milky \Nay Muriel The Story of Adele H A Study in Terror Sunstruck Suspira T[...]t Ta ras Bulba Ten Rillington Place That Obscure Object of Desire Borsalino Le Boucher The Bride Wore Black A Man and a Woman Mr Klein Mon Oncle Straw Dogs L’Homme de Rio There's a Girl in my Soup The Lacemaker Lady Sings the Bl[...]Henry V Death on the Nile Dr Dolittle Dracula A Bridge Too Far The Charge of the Light Brigade Zazie Dans Le Metro A Touch of Class You Only Live Twice The Pink Panther The Pink Panth[...]em Face of a Fugitive The Family Way Fat City Fedora Fligh[...]alileo The Gambler The Garden of Fitzi Continis The Glass S[...]Sam The Curse of Frankenstein A Day in the Death of Joe Egg The Discreet Charm of the Bourgeoisie A Dream of Passion Eagle in a Cage El Greco El Topo Butley Capricious Summe[...]The Blue Peter The Bottom of the Bottle Macon County Line Major Dundee[...] |
| [...]gler The Boys from Brazil The Boys in the Band A Man Called Horse A Man for all Seasons Midnight Cowboy[...]f Navarone Hello Dolly Shampoo A Shot in the Dark Silent Movie Slap Shot Soldie[...]ET From pre»production to premiere, Kodak Kodak and its range of Eastman film prod[...]color print film W hen you next make a film, ensure you have The world's greatest film makers have, and as |
| [...]rding and Mix facilities. These features release you from the frustrations and delays you have experienced and enable you to have SIGHT & SOUND 50TH ANNIVERSARY ISSUE: A[...]ort films entering and a definitive list of its cast and technical credit[...]ion assesses silent and early sound features and a new Video section reviews selected Please return this form with a cheque or postal order [crossed and made payable[...]titute, 81, Dean Street, London WIV 6AA Name |
| [...].. Monte Carlo, 3 _ NATPE, American Film Market, A 1 MlP—TV, Cannes, London Multi-Media Ma[...] |
| [...]i 1 db)_ Motion Picture Services P O. Forreston S A 5233 Backed by Filmwests proven spares g[...]represent the best shooting value on _ A.‘-Ex "°""E.E the market today. Especially whe[...]3 '" §','y'",3’§s‘ E““"""°"‘ 53'“ you compare Filmwest‘s price list. A_U5t'3"3 ""0519" 33 30553.6 Road |
| [...]ht films I 9 wrapped up the zhgustralian Film t S a. Institutes awards. All eight were processed by[...]ward—wirming process all wrapped up. Just take a look at this year's winners. |
| [...]on 567 The Sharkcallers of Kontu Solrun Hoaas 568 A Midsummer Night’s Sex Comedy Margaret Smith 569[...]ional Film E.T. The Extraterrestrial g"dRTl‘_’a::efi|' B°°" 1931'” 572 Phar Lap Reviewed: 56[...]ne, neither the editors nor the publishers accept any liability for loss or damage which may arise. Thi[...]of actor Mel Gibson (who plays Guy Hamilton) and a scene from Peter Weir's The Year of Living[...] |
| [...]go major reorganization. has not as yet appointed a replacement for Dimsey. In mid-November, the Vic[...]e circumstances have One motivating[...]ain of creative talent over the border to Eady Fund While[...]ype of govern- There, tax is a[...]he British Films Minister, The ACTF also revealed that it would Peppino — $5420 for first-draft funding Easton was born in Sydney and once Melbourne Festival New appoin[...]tival A billboard image from Times Square, New Yor[...] |
| [...]combining an entertaining live per- formance with a popular distribution of awards among many films.[...]first controversy was over the implementation of a pre-selection process, which ‘narrowed’ the 30 films entered down to 18. (For a full report see 1Cg£e;'na Papers, No. 37, pp. 10[...]r, as required, the nominees were jumbled — not a serious error except for the donkey voters. The[...]p two Finally, the closing date came and Tradition It is the prerogative of any organiza- The executive directors involved[...]Peter Crayford. Of Overall, the whole incident put the AFI Eric Porter, winner of the Raymond The Presentation For those present, the 1[...]and to the point. As compere, Looking at a video recording later, As a result, when the ABC agreed to Awards presenters David A[...]audience bewilderment returned. It is certainly a problem that needs to The A wards The awards themselves require little Best Performance by an Actor in a Best Performance by an Actress in a .Best Performance by an Actress in a Supporting Role: Kris McQuade in Best Performance by an Actor in a Best Short Fiction Film: A Most Attrac- |
| [...]that Scott said in this piece and if there can be a recognition of these basic facts, then actions by people of goodwill will have a chance of moving the industry fonrvard once more.[...]fter all, there is nothing wrong with cinema that a damned good film won't cure! Yours sincerely, G[...]the point is well made that it is In an international industry, true talent Producers whose f[...]UAA’s opera- Bob Ellis,[...]ne else for that matter Overseas directors should be allowed |
| [...]ldsworthy epics, Sunstruck, The Shiralee, Squeeze a Flower, The Siege of Pinchgut, and so on). Just b[...]ng was twofold: 1. UAA has acted within the law, a fact 2. T[...]than an elected Any legal difficulties relating to other Australia[...]op. Further production investment in the Additionally, a grant of $3000 towards A total of $105,083 was allocated to Additionally, Crawford Productions Cowarle Holdings has been allocated |
| Peter McLean VVE FTHE NEVER NEVER: A DRAMA 0F Pre-production When did you start work on “We I bou[...]e first introduced to it at After I’d had a shooting script Phillip, as exec[...] |
| [...]leave the production? John joined the production a You sound a little circumspect . . . I am determined in this[...]to avoid ambiguities in answering 506 — December CINEMA PAPERS[...]l. We of the Never Never. We sort of folk? Yes, you know, people who Why did you decide to shoot in the One of the complaints that Dan, a Yes, even though I had spent It is a special part of the world. it while we were there, almost as if Is that another reason why you I don’t see remote l[...]It is part of the ..a‘§’ tion on the film wasn’t as tightly Peter Schrec[...]itations are enormous, |
| [...]the possibility of severe criticism for damaging a classic. Whether or not we will escape that, I do[...]rthern Territory. That exploration becomes almost a personal justification, on behalf of the white pe[...]the way of life out there. It doesn’t read like a personal story, but I believe it is. I think she[...]d the book to be an Why did you decide to include the Do you think it shows a contrast The book is written in the first No, though we did consider re- The relationship between Jeannie But it wasn’t really a story of Igor Auzins about her position as a married How did the Gunn family react to[...]elt those Do you see any similarity between They identified wi[...]. It appears that the Western CINEMA PAPERS December — 507 |
| [...]whereas in We of the Never Never perhaps they see a Western form that doesn’t have an edge of harshness and cynicism. There seems to me to be a common It is a reality in those sorts of What about Jeannie’s comment The concept of herself as a wall- s- '~"-* '. . \ . 3,, 14.}-{;'.). c[...]ncep— There seems to be a stronger feeling We tried to describe somethi[...]cribe. We tried to Certainly it is not an absolu[...]d in the book, though I A film can only possibly deal I had trouble with the scene where Exactly. I am delighted you had Yet, when it actually comes to a As a character she is by no |
| [...]Is the corroboree at the end supposed to indicate a resolution of problems? It is an indication of acceptance It is not a change we made. That The book does read as a racist I can’t tell anymore. Do you I think it shows that the men[...]nals are heathens You don’t believe that there is Why did you use sub-titles? I don’t think it is appropriate to their own. We wanted a device that If you must trivialize events, what Well, you hope the moments explain or background the moment I assume that through a whole A film obviously isn’t a defin- How did t[...]hey They cont[...]and the script’s concept Were they satisfied with the way What about the Bett-Bett char- in the book, but a central one in Concluded o[...] |
| [...]December CINEMA PAPERS other way, it looks like a characteristic Schrader work. The heroine, Irena the curator as a romantic idealist in search of Thi[...]Brian De Palma’s used also as a correlative to human savagery and, as Schrader puts it, “the fear in our society now that there’s a monster lurking |
| [...]not an animall”, as he batters his head against aa Schrader character tears himself to pieces psycho[...]the dubious achievements of Cat People is to give a whole new dimension to the word “pus”, as the[...]ves disgusting evidence of its imminent presence. A hand becomes part of the garbage in Rolling Thund[...]o clean and purify becomes indistinguishable from a desire to expunge and annihilate. One should be[...]there shadowy and rat-like, he is a will fixed and gripped like a trap. He is not nice.” chrader might be called a junk-food |
| [...]s the cage at the end of Cat People as if it were a shrine, and, as the cat stares back, the David Bowie song intones the lyric: ‘‘I could stare for a thousand years, and don’t you feel my blood enraged.” All four films conclude with a movement into Cat People is something of a departure from make you dream. The goal of Cat People is to he dark side of li[...]: the preenings of When a worker in Blue Collar (1978) 512 — December CINEMA PAPERS The reclamati[...]r is also from UCLA. Having classic noir films of the 1940s and 1950s but may have helped to create a climate in which the form could be revised and I[...]allusion to Shakespeare’s The Winter’s Tale. A 6. The film is subject to a contracted legal dispute over |
| [...]is ‘Debbie’, Iris (Jodie Foster), centre, and a friend (Garth Avery) in Martin Scorcese’s Taxi Driver. his wife and daughter, but, after a remorseful Obsession is a critical work of interpretative Although The Yakuza borrows o[...]hcock, W. H. The search for a lost daughter: Jake looks at a porno film It is the madness in[...]evenge thus becomes an elaborate axi Driver is more uncompromising. aging Bull alludes overtly to On the Three images of "a blond heroine classier than themselves but representing a desired vision of genteel womanhood, a sense of softness in a hard world”: Travis and Betsy (Cybill |
| [...]so. Brando’s hero represents the confusions of a typical rebel of the ’50s; De Niro’s that of the alienated anti- hero of the ’70s. Brando is a rebel without a cause; De Niro a rebel without a brain. Brando’s solution to what he sees as cor[...]or angry young men. They are heroes who challenge any attempt at identification or moral approval. (As a British critic observed, Raging Bull could be subtitled: “Somebody Up There Hates Me.”) They reflect a contemporary confusion and scepticism about heroi[...]ality is personal, private and idiosyncratic. If aa 514 — December CINEMA PAPERS a critical essay on the changing fashions of A clue might be found in his creative method. |
| [...]in his own ‘cage’. Taxi Driver. the diary of a madman. Blue Collar also avoids his life at that moment and then find a dramatic metaphor that corresponds sl[...]e of Hardcore has a brilliant premise. George C. Old Boyfriends has a promising concept |
| [...]allacoota Stampede indicates), but the failure to find government funding has not, as it has with others[...]“avant-garde” are now less popular. There is a wealth of meanings and nuances. The situation of[...]get, usually on the basis that the filmmakers and any other personnel involved are There is aa film project I would not count him as a ‘natural’ filmmaker. His methods do not have any smooth Tammer’s most recently-complet[...]the End of Night, is so far his only |
| [...](Tom Pye) discuss her leaving home. In the films you made through the Eccentric is a bad word because The only time I have made a film What attracts you to your I don’t have a rule. I don’t look I prefer to work with st[...]ousands. I want to work on an 1. A Woman of Our Time, Here’s to You You have called this form of work _ I see my films as one of[...]pre- That is true of Here’s to You Mr There is a great difference I take as a basic departure that Now, how much one pushes a The first three takes we[...]- You started making films literally |
| [...]e Did “Mallacoota Stampede” start No, Mallacoota was always The second level was meant to Then there was a third level, “Mallaco[...]mpression of improvized drama. The casting of the people who I took a punt down there and either all or nothing at that stage. So, yes, it was a conscious deci- Unless it was budget, why did you Partly because I like[...]ioning How do you expect people to react It is not so much what[...] |
| [...]I want and the tightness they want. Can there be a confusion between That confusion will be illum- A war-time photograph of Neave. Journey to the End[...]ncentrate on Bill Neave sets a charge during the war in quality, he[...]mentary than Is there a distinction in the film The whole film is a recreation. What gives the film its interest is a Neave as seen in Journey to[...]ons. I believe every film poses Francesco Rosi’s films, for The q[...]men- They are meant to have a mul- I don’t share[...]ation. According to Celine, we are You would obviously reject the There has been a good string of |
| [...]ible to make an objective judgment of the work of a filmmaker without first seeing a major part of the output? Director Raymond Longford provides a A newcomer to film history research was LEGACY m[...]’30s, the Victorian The Pat Hanna produc[...] |
| [...]d. Over-riding their lack of cine- matic quality, a high technical and artistic quality allows most o[...]unpretentious shorts — to ‘ride well’ with a modern audience. The Efftee Entertainers shorts, for instance, fftee films all reflect a rather naive and idiosyncratic Australia between[...]ttler’ comedies, Dorothy Brunton’s dreams of a better life in Clara Gibbings and Pat Hanna’s[...]ies, the escapist element is evident, presenting a ‘chocolate box’ vision of Australian life.[...]tching for gold in the gutters of Without exce[...]m print of the Of the five Great Barrier Reef[...]Murray.) each film. In several cases, during a search Until a thorough documentation of Austra- Sound: A/an Mill; Alan Stuart; Jack Murray (RCA Photo- ph[...]Made in the (chronological order) A Co-respondent’s Course (44 mins, rel. 6/11/31) P.C.: Efftee. Dir.: E. A. Diettrich- Gladys Moncrieff and Rober[...] |
| [...]: F. W. Thring. Talkie adaptation_of C. J. Dennis poem, starring Cecil Scott and Ray Fisher. N.B.: the N[...]an down-and-out who dreams that he is the king of a small European country. Stars George Wallace, Joh[...]mond Longford. Wartime comedy starring Pat Hanna. A sequel to Diggers. Waltzing Matilda (87 mins, r[...]ord. Comedy of returned A Ticket In Tatts (91 mins, rel. 6/1/34) P.C.: Eff[...]of 1933) P.C.: H[...]empt at an Australian equivalent of The Birth Of A Nation. Stars Peggy Maguire and Franklyn Bennett[...]7 mins, (8) Melody and Terpsichore (7 mins, 1931) Violinist (10) Stan Ray and Geor[...]ns, 1931) Impressions of Gracie Fields (15) The Sundowners - H[...]character “Dr. Mac", (18) Kathleen Goodall — Songs At The Piano (No. 1) |
| [...]liana Cavani, like compatriot Lina Wertmuller, is a controversial director. Not only have her[...] |
| After graduating with a degree in Classics at the University of Bologna, you attended the Centro Sperimentale di Cinematografi[...]young people in successive years were deprived of a school. It was the only one for cinema which exis[...]ed badly. In most American universities They are no[...]estroyed, and hopefully they will Do you think you would have gone I applied for a post as a func- I did have a bit of trouble because we were dealing with Saint Galileo Galileo grew out of a co—produc- There were a lot of problems L ’ospite (The Guest, the Host) The Guest, the Host is a film I In those d[...]o were not neces- The Guest, the Host was the Now they have closed down a lot Sometimes reading a book does I made it for television on a low It is fair enough to s[...]lly with Top to[...] |
| [...]critics don’t help at all. The more ‘poor’ a film is, the more they go for it; it is ludicrous[...]oman who said that every year she goes to Dachau, where she had been a prisoner, for her holidays. This made a strong impression on me. I would prefer to go on[...]ilan, who, when she returned home after surviving a camp, was greatly annoyed that people treated her like a poor wretch. It got to the stage where she couldn’t stand her friends and relatives.[...]epths of human nature. We always think of this as a positive thing, because we look for the better si[...]d, “The physical suffering passes; this won’t ever go away.” A story slowly evolved from all Top: Lucia runs[...]Cavani, during a break in filming of Beyond Good ac[...]rave. They are very For example, if you make a film I grew up in the post-war era. In fact, you were not allowed to certain things, such as many Fascism. You start to see things as Fascism opened the doors for all |
| suddenly there was a mass of them. But the world has always been this[...]t we are made from. Did things become easier for you Ind[...]had that I don’t find these women physi- Ac[...]king love. I really don’t think that things Sure in Italy when a woman So, I don’t believe that Italian Germaine Greer went to Sicily in Do you always collaborate on a If I were offered a screenplay do i[...]one films with a collaborator or, as in the You have been quoted as saying It is always better to tell every- |
| [...]graphies take up several, good—sized shelves in any performing arts bookshop. Twenty years ago, an ac[...]and Shaftesbury Avenue, from Tallulah Bankhead to A. E. Matthews, were trying to persuade us that the[...]have the enthralling saga of your life take its place on the shelf with all those other lives has become a tacit admission of not having made it. Mere decent reticence in the face of aa still more disquieting sign, there is a new trend |
| “They ’re not stars for no 9? reason, you know . . . Film stars are so much a phenomenon of a On the basis o[...]frittered away my youth in recent Having achieved not merely any role but the To know you are a film star is, presumably, 4. Michael Freedland, Gregory Peck, W. H. Allen, 1980, 5. Charles Higham, Bette: A Biography of Bette Davis, may wish to present their subjects as a moral" mixture of Little Nell and Mother Theresa of 7. Kenneth Barrow, Flor[...]. Allen, 1982, p. x. |
| have offered just a carefully preserved public The Biography Industr[...]ey Winters has Productions were built around the talents of , A . - — = V ~ — _, ~ ,_ ,, on a star for a film’s success or failure, the |
| [...]self- dramatizing, obsessively ambitious and, “a woman whose brilliance and , aggression prevented her from achieving fulfilment in a relationship.” The one great, positive attribut[...]rely more to Now Voyager than “. . . of course, a camp classic, a masterpiece of schmaltz”. Higham (and Joel Gree[...]ce, mascu- line security, strength that disguised a fawning servile weakness”; at Paul Muni — “withdrawn, haughty, never a mixer”; at John Farrow, “a boorish, drunken lecher with a foul mouth”; at George Brent who was “mean- spirited, tough, and handicapped by a wickedly vicious tongue”; and at that “small,[...]say to 1941, she was less and less likely to have a leading man who could draw her full fire —- either on—screen or off. Possibly a terrible woman, Davis is Power established quickly a potent romantic century. But, with the backing of a shrewd and Teichmann, a man of the theatre, tends to are doing all the projection you need. No And Teichmann adds: “In almost a hundred films the technique Fonda employs has no[...]l mobility as possible. Whatever he plays.” (p. 98.)[...]thm of film-making”, believing it to be 13. Elizabeth[...] |
| [...]could do anything false, he’s incapable. As a performer, as a man, he’s pure”, Sidney Lumet claimed, and if[...]ral; according to Teich- mann, there is more than a little correspon- dence between the screen person[...]or issues; and in some of his chief relationships a stubborn integrity emerges, not unbecoming Tom Joad, Wyatt Earp and Barney Greenwald. f Henry Fonda made a career out of persuading us to take him seriously, whether in a humid jury room or bringing order to the wild We[...]— especially West’s 19305 films are now camp classics, a If none of the remaining six films s[...]with W. C. It was, however, a triumph of subtlety, wit Sextette ( 1978), in which she plays the bride of a young English aristocrat. But it is absurd to.[...]er tried before”) and Cashin does well to |
| [...]and Maude (directed by HalAshby) was the basis of a continuously-popular cult film. Subsequently he w[...]treal Film Festival, David Stratton. Apparently you grew up in Sydney Yes. Actually, I was born in After Pearl Harbor, my father[...]r While serving as a jury member at the 1982 old Chalmers St office;[...]y How did you become interested in At first I wanted to be an actor. The[...]direct. I was accepted What sort of films did you make at I made two: Opus One was a I was very lucky. It was a pretty CINEMA PAPERS December — 533 |
| [...]for “Harold and Maude”? It came from seeing a dolly Then I thought, this is a bit grue- Ed, who was making a film at But it became a success eventually Much later. In the meantime, I Then out of the blue I received a While in P[...]company as “playwright-in- Well, by now Harold and _ Arthur is a very sweet man. He |
| treats the script with a great deal of respect. If I had directed it, I would have been a bit less faithful to the writer; I would have sla[...]self must have made working with them easier when you directed “Foul Play” . . . Yes. Goldie Hawn is a joy to Dudley Moore, of course, was What visual style did you go for? film with sharp colors[...]in Co/in Higgins’ What attracts you to comedy? I have great satisfaction in Do you find writing easy? I would not say “easy”. It is[...]e in it, and at the same time In the early days, I[...]editative state, or whatever that to write anything is a kind of How did you come to do “9 to 5”? I was approached by Jan[...]ul Play. I Essentially, no one[...]r I started working |
| [...]the problem was that the Broadway show was about a sheriff who was 65 years old and a madam about 45, who had a relationship about 20 years before, a one—night stand in Galveston. It was clear to m[...]re- house. Considering how expensive it is to Many American c[...]he I cast Charles. He is a very 536 ——- December CINEMA PA[...]uence. We did it on location in Do you think there is a problem Well, we di[...]osite directions. But finally I I am not entirely satisfied with The reason I loved doing Now that “Whorehouse” is a big I can, as you say, get finance comedies? projects Probably. I have a couple of |
| [...].... ....; .; r 3‘:- . ‘V I Y3 1- .15‘ A "' ‘ii '2' A I » ~- I .,iu1.\\ -u_.-.1‘ " |
| [...]ly revised and updated. The Yearbook again takes a detailed look at what has new categories have been added. A new series of profiles has been compiled and will[...]Weir, composer Brian May and actor Mel Gibson. A new feature in the 1983 edition is an extensive effects, censorship, and a survey of the impact our films are having on U.S[...]nal “The Australian Motion Picture Yearbook is a T I?eactions to the Second Edition «A ._,A ~<'x ....—_.».-.\...,,. “Anyone interested[...]. ” “May l congratulate you on your Australian l " 3"U)u;u ]1,.A\.|“_ "The 1981 version of the Austral[...]is easy to read |
| [...]lllllllARl' t fifi Documentary films occupy a special m¢....__=;a,,=:.. ......,..,_... The History of the Documentary: A World View in Australia A general history of the evolution of the documenta[...]ntaries ' Making a Documentary A series of case studies examining the making of Repositories and Preservation A survey of the practices surrounding the storage a[...]isons of procedures here and abroad. The Future A look at the future for documentary films. The imp[...]t affects production, distribution Producers and Directors Checklist A checklist of documentary producers and dir[...] |
| [...]opher Day, Ivan Hutchinson. AUSTRALIAN TV takes you back to the time when television for most Australians was AUSTRALIAN TV is an entertainment, a delight, and a commemoration of a lively, fast—growing industry. In November 19[...]film and television The symposium was a Tape recordings made of the[...]tudios 0 Presale of Rights Presale of Territory MAR 85%[...]ebirth,]2 |
| [...]p‘ ;’ . ésniact . Rory ,WiJk$ 0? éiyan _Gij_aa a '7 , ‘ _'z 5 0 Cor’ st[...] |
| [...]ing Service journalist, arrives in Jakarta during a time of political upheaval. There he is befriende[...]iving Dangerously is directed by Peter Weir, from a screenplay by David Williamson (based on t[...] |
| [...]nce. It is true that the film’s Lincoln High is a dingily—depressed school, that its central gang is sometimes a variation on Alex and his Clockwork Droogs, a[...]cular-saw slashings, he film pres[...]ts. “Unreal”, “exploitive” a[...]ecember CINEMA PAPERS The punk gang attacks a black student. Mark L. Lester’s Mark L. Lester’s films have usually had a film, has been shown on television. In aa great deal of B—feature territory, |
| [...]ark L. Lester . . . has an astute eye and ear for a cliche, and knows better than Hawks ever did how to invert it to expose its absurdity. He also has a very witty way indeed with casual details and thu[...]ntions. The filmmakers know that if they suggest a Lester choo[...]hooses Lester is also a film-buff director. Allusions The kids assemble for classes in a style The terror continues:[...]hat Norris is pursuing decency within Bikies interviewed after a 1979 preview of Norris fights back[...]audience sides with him. Class man and a would—be call girl). The principal |
| q. 0'. . Q -'.. . ' ' O . . , ' Ti.-IE _ * .- ‘ Qompuinix Iii automation'and Dolby Sierea -- a n°evir era f6; the film ‘produce T ° .: _ who is looking» to a standard of gognd mixing and optical track[...] |
| [...]$5.85 (Air) (Air) (Air) (Air) (Air) (Air) NOTE. A “Surface Air Lift" (air speeded) service[...] |
| [...]. David William- son. Richard Rush. Cuban Cinema. A Town Like Alice. Flash Gordon Channel 0/28[...] |
| [...]S Overseas rates In 5 Subscriptions Please enter a subscription for 6 issues ($18)D 12 issues ($32)[...]D renew D my subscription with the next issue. If a renewal, Address: Country: Telephone: Gift If you wish to make a subscription to Cinema Papersa gift, cross the box below and we will Subscr[...]each (save $2.20 per copy) To order your copies place a cross in the box next to your missing issues, and fill out the fiwbn Please turn overleaf 7 |
| [...]ease send me D copies of the 1983 Yearbook at $25 a copy (Foreign: $35 surface; $45 airmail). £4538[...]nd me E] copies of the 1981/82 Yearbook at $19.95 a copy (Foreign: $30 surface: Please send me E] copies of the 1980 Yearbook at $19.95 a copy (Foreign: $30 surface; $40 airmail). 9‘ .[...]E] copies of The New Australian Cinema at $14.95 a copy (Foreign: $20 surface; $26 airmail). Aasi[...]es of Australian TV: The First 25 Years at $14.95 a copy (Foreign: $20 surface; $26 airmail). *: .[...]e D copies of the Film Expo Seminar Report at $25 a copy (Foreign: $27 surface; $32 airmail).[...] |
| [...]ercial industries have been fortunate to have had a tradition of invention and a supply of creative technicians and audio-engineer[...]s now being serviced by audio post- production of a quality that will allow it to present its material at a standard equal to any in the world. The continuing improvement in the[...]are also increasing the range of subtleties that a chartered accountancy, before getting a I then worked for Les Kelroy, who had a I became a freelance recordist on the locati[...]tudio work and do the Julian Ellingworth, during a sound mix. x ‘. . . two plus our computer”:[...]e others sat I was at Film Australia for a total of 10 It was a great experience working with The console was made by Neve, which After leaving Film Australia, I freelanced I was away for six weeks and watched of information and a lot of tricks about how Did they welcome you? Yes. I was not allowed into a couple of films. I saw them do The Muppet |
| [...]and won an Academy for Ordinary People. So I saw a lot of top people. It was Yes. Certainly there were a lot of guys How do you stop that happening in Well that is exactly what we don’t do I had done the trip and learnt what I sound studio at Atlab. In all[...]Sound We had a few problems building the The only choice was between a custom- are completely music desks and, in any To my knowledge, Neve does a very We came up with a proposal for Quad- It started originally as a quadraphonic Surely, that is the reason for having a Well, the Americans wouldn't entertain Do you have three or four people on the Three or[...]g console in the the Allab sound theatre. for a week and we reworked it so that it They wanted, once again, to tack on a “But, all this part of the board is going to waste. If you want to change all those buttons to something el[...]puter acceptance has not been large Do you have to program the computer What about equalization? It doesn’t nee[...]the stereo mixes When you have a couple of four-tracks don't you bring this in earlier”, you can In effect, it is replacing your memory, And allowing you to rehearse as many In Melbourne, where there is no decent ferred at one place and mixed at |
| sound recordist having a supervisory role in this situation? I think it would be dangerous to bring in said, "Thank you but l’m mixing this film!” Do you think there is anything positive What there should be is a pre- There also needs to be a big sound There has been a certain little protec- That is what you have to do with mono With stereo it is slightly different. You Do you see any improvement in sight Th[...]non-standard print reversal medium years ago and no one Are there any technical reasons why a No. Certainly they have the expertise Magic Sound for “A bra Cadabra ” The soundtrack for Abra Cadabr[...]nt channels and one rear Abra Cadabra stars th[...]techniques of tape, But it is not only a matter of film being The principal raw materials of the film[...]intain maximum Chec[...]own diagnostic pro- After the p[...]transported to the processing machine As the developed print comes off the[...]em to the micron Why are the[...]cron radio “TEST For further information contact the[...] |
| [...]tainment . . . to all the performing ~ — ‘ ' A RIUMPHAN 0 Great variety of locations available w[...]Special Attractions: STUNTS SHOWS-COMEDY SHOWS- a cLowNs . . . comes a story you ll never forget. JOIN THE CALABASH CLUB V ' ' 7, A private recreational facility for the Entertainme[...]1 2114. 5 5 SUPER-B PTY. L|MlTED A PROFESSIONAL Now available![...]ty Super 8 or A § Q r er det ils contact Suite 4 ieii2a:i‘ie°i;2:i.2:::;:2:am;=e:::“i"sW=*e'i[...] |
| [...]rdmen oi Kilimanjaro (16mm): Australia, 767.90 m, A. Folland Der alte und der Iunge ltoenlg (16mm):[...]00 rn, German Embassy Der schlmmeireiter (16mm): A. Weidenmann, W. E.T. The Extra Terrestrial: Uni[...]r, W. Germany, 990.00 rn, German Embassy so That You can Live (16mm): Cinema Action, Britain, Born To Kill (16mm) (a): RKO, U.S., 1012.00 m, lhr verbrechen war lie[...]ist. P/L, O{sexual Rolls, Rolls I Love You: R. Shaw, Hong Kong, (a) Reconstructed version registered "Suitable Only[...]—m-)'), O(adult concepts) Conan The Barbarian (a) (reconstructed version): Dino Desolation[...]Gratuitous Ria|tolMaran, W. Germany, 2852.72 rn, Far East: Fi[...]P/L, My Survival As A Deviant (Super 8): G. Lewis, Aus- Partners: A. Russo, U.S., 2496.13 rn, United |nt‘l A Question 01 Silence: Sigma Films, Netherlands, S[...]oadshow Dist. P/L, L(f-m-9), O(sexual (a) Reduced by importer’s cuts to qualify for lowe[...]The Bloody Fists (videotape) (reduced version) (a): (a) Previously shown on January 1973 List. (b) See[...]0, 1982 and then exported. Reason for deletions: O(sexua/ exploitation of a minor) Deletions: 6 metres (13 secs) Reason for deletions: S(i-h—g) (a) Previously shown on January 1982 List. (b) Prev[...]n: E. Dietrich, W. Germany, 2207.00 rn, Filmways A’sian Dist. PIL, S(i-h—g) Kiss 01 The Spider[...]rror (soft version): W. Evans, U.S., 2639.00 rn, A.2. Assoc. Film Dist. P/L, S(f-hg) Pixote (English sub-titled version) (a): S. Naves, Brazil, 3490.00 rn, Consolidated Exhibitors, O(sexual exploita- tion ol a minor) Scream For Vengeance: Manson lnt’l, U.S[...].S., 31 mins, Rahima Prods, O(sexual violence) (a) See also under “Films Registered Without Elimi[...]hopstix (reconstructed pre—censor cut version) (a): W. |
| i AGFA-GEVAERT re’ wh you should cose for[...]with the Its a film that passes with flying So ifyou’ve got t[...]how, and the will, we’Ve got the |
| [...]vision Cast: Hugh Keays-Byrne (Quin). Synopsis: A suspense thriller horror film of a .Anne[...]ooks desperately for refuge. Synopsis: A contemporary comedy. The Cast: Ciaud arvan (M e). Synopsis: A contemporary fairy tale about THE MOST WANTED MAN Prod. compa[...].Patric Juillet Cast: Roben Menzie ( . Synopsis: A romantic comedy based on C. Art director . . . . . .. .A|exander Stitt Musical director .. .._..Pet[...]tand-by wardro e.. Margot Lindsay Synopsis: A re—make of the film made in oilteenagers in pursuit of two would-be horse CAREFUL, HE MIGHT HEAR YOU Prod. company .Syme international Prods[...]ore. |
| [...]Scriptwrit .Charles Stamp Photography. Phil Pike A.C.S. Sound recordis Don Connolly Editor .........[...]. . . . ..Meredith Baer, Hilary Henkin Based on a story by . . . . . .. Meredith Baer RUNNING MAN Prod. compan[...]Quinnell Based on the novel .W. A. Harbinson Sound recordist N[...]Mark Lee, Ralph Cotterill. THE[...]ordist. Max Bowrin ally Ayres[...]Dennis Grosvenor (Reilly). Synopsis: Two men and a girl set up house at what goes on in an Austral[...]per (Sally), Jon Darling (Bob Henning). DE[...] |
| [...]ny Barry (Ozzie), Max Phipps (Francis). Synopsis: A love story in a combat zone. Every city has one. DESOLATION ANGE[...]aside reson of Portsea. Three Synopsis: A psychological thriller, its plot is Dog trainer. .Mary M0Ci'a!-‘lb Synopsis: A suburban community is bliss- Synopsis: A remarkable relationship be- Shooting stock . . .[...]disturbed 13 year-old boy. Tom is written |
| A brand new double feature from Sammies Introduci[...]e and our newly completed commercial sound stage. SYDNEY: 1 Giff[...] |
| [...]iney). Paul Chubb (Curly). Synopsis: She was all any old fool could ask ..Anton|a Barnard Synopsis: A young woman. looking after MIDNITE SPARES[...]. . . . . . . . . . . . .Wednesday A Filmco Presentation Producer . . . . . . . . . .[...]ty life. accept his ltalian hopefully one more step t[...]dren cross the 3rd asst director .. .. Bob Donaldson |
| [...]ent), Henri Szeps (York). Synopsis: The story of a stylish Sydney S nopsis: A chase drama about a callous Synopsis: Two men work in a satellite relay Unit cars . . . . . . . .. Thrifty Rent A Car Synopsis: A madcap, musical comedy- A SLICE OF LIFE[...]amond Sound record t .. ....Pau| Clark[...]Pinkus (Addy), Gwen Synopsis: A young man goes into hospital |
| [...]Hatfield Photography . . . . . . . . ..Phil Pike A.C.S. Sound recordist . .. Rowland McManis Editor[...]fairs with visiting Russian ballet dancer becomes a matter of concern to the family when it has a dramatic effect on several of the business enterp[...]t Burgess, Tony Barry, David Downer. _ Synopsis: A dramatized reconstruction of Synopsis: A chronicling of the growth ofjazz KUMBHA MELA — SAME AS IT Albert Falzon Creations THE LEGEND Synopsis: Twenty- ive a ults and children PLEASED TO SEE YOU Prod. company Aardvark Film Prods Director[...]f the SHORTS JULIE JULIE[...] |
| AATON A ustralian dz'stribut0rs.'— (INCORPORATED IN N.[...]their executive, for |
| [...]got sick of living in Broken Hill, so she bought a motorbike and left to ride around Australia. The[...]Walker (Jane); Gaytana Adorna (Maria). Synopsis: A short drama about the conflicts national, is secretly deve[...]n hands. They resolve to sabotage Utero and make a Synopsis: A humorous look at the role of the A shitting Dreaming —— Imago Australia — Love on a Tourist Visa —- Jan Sharp; A Grave for a Dolphin — McElroy Peter Tammer Vic. ; rant for Tri t ch A Max Bannah (Old); grant for Bi[...]— $18,411 John Prescott (Old); grant for Just a Whiff of grant for Sacred Wom[...]Series — Film Victoria is currently Documentaries Thomastown — A documentary on Thomas- NSW FILM WASTE DISPOSAL - Prod. company ..........[...] |
| MIXING POST-SYNC RECORDING VOICE-OVERS We have a well equipped sound department STUDIO MANAGER STUD[...]KEM 800 SERIES: YTHING IS POSSIBLE When you edit with KEM, Phone: 3251177, 5 A f “O Chandos Street, Singapore 0718. 32[...] |
| Lonely Hearts Keith Connolly Paul Cox’s Lonely Hearts is a neat A sad little social comedy with Though the char[...]adylike counterpart, tion, too, that Peter has been only too bolic, but there is a little of Peter and Patricia in many Australians[...]eenplay As well[...]ossy and interfering Dad. Cox and Clarke concoct a small but |
| [...]idents, such as the blind-piano-tuner episode and a nervous assignation with a call-girl, rattle about rather loosely in the narra- tive structure, giving the impression that a certain amount of post-produc- tion revision has[...]er (Ron Falk) who brow- beats Peter into ordering a new hair- piece. (A far more important charac- ter, an amateur theatr[...]r shortcomings notwithstanding, Lonely Hearts has a consistency of imagination and func- tion that is[...]in the bumper crop of 1981-82. It is, in short, a triumph for Cox and The Best Film award as[...]ies in Whereas most of Rosi’s films were Although there are similarities i[...]nds that now a judge living in Rome with his usually the case with the second son of The youngest brother, Nicola[...]ned with Three Brothers opens with a still The fact that Rocco is the f[...]y his side during |
| [...]not feel much sympathy for the establishment. As a result, their arguments tend to be very emotional[...]ar of losing his job that stops him from becoming a terrorist; this belief reflects the emotional dif[...]murdered. Rocco does not want to help the about love: love for parents, a wife, a little girl; love for nature, for one’s own di[...]nt that Platonov’s The Most effective of all is a dialogue tears, accompanied by a discreet and Rocco drea[...]weapons, syringes, money and “In my life I want to live at least a day like a lion “And the state should not condemn me, be[...]razy.”‘ He then mentions Masaniello, hero of The artistry of Three Brothe[...]e 4. “Nella vita voglio vivere alemno[...]o understand “He lent us all a sort of serenity. During filming he was like the[...]e cadence of his movements.“ Three Brothers is a very special film It reflect[...]paradoxically, very real. At the Three Brothers[...]ind. What my These shots — and a great many that 6. Interview with Rosi, Sight & Sound, follow —- offer a ravishment to the |
| [...]and she is unable, by her physical presence or by a sense of inner conviction, to transcend these. Ag[...]quacy: In the opening scene Jeannie is warned, “You must never lose your femininity” and “Don’t try to be a mate to him”, but the prom- ising irony — as[...], the film hardly seems interested in her role as a woman: there is a promise of warmth of feeling between her and the[...]considered using the white woman’s situation in a male-dominated world as an organizing narrative p[...]cial issue but does nothing about it. It is again a matter of scattered remarks and incidents: of Jea[...]tt into the house despite Aeneas’ claim that “you can’t take her away from her people”; and so[...]he dies, she asks, in plaintive anach- ronism, “Where did we go wrong?” The jejuneness of the film’[...]Chinese cooks, one spitefully inclined, the other a comic character who raised indulgent laughter fro[...]hing as vulgar as an adventure; and it lacks even a good car for a period piece. What we are left with is the Marlboro look and sound of the Australian outback wedded to a quite exceptionally dim little story of this and[...]stars are twinkling brightly in the night sky. In a secluded clearing of a redwood forest on the outskirts of Los Angeles, a[...]aft. Long, delicate, brown fingers gently uproot a small |
| [...]eople would deal with it. In Polter- geist he set a graveyard of ghosts onto the home salesman and his family; Roy Neary had his first close encounter with a UFO while on the job; the supershark in Jaws terrorized the sleepy coastal resort town of Amity Island; and a man quietly travelling the country roads of the Midwest is attacked by a maniac driving a decomposing tanker in Duel. Incred- ibly, all the[...]Allen Daviau’s practical method of lighting — where, for the most part, the lighting fixtures shown a[...]Spielberg’s re- creation of suburbia invaded by a small, brown alien. E.T. is, perhaps, the first film in E.T. is purely and simply a joy to The young and the not-so-[...]uashy guy’ from the stars. For some it will be Steven Spielberg has made, in E.T. Scenario: the hero, confined to a deceptively simple plot in a film which The early scenes in the film es[...]emise: Ballinger’s tradition largely ignored since the It is always a somewhat presump- material. However, one cannot resist |
| sTAéE”i& TDIO GROUP J .a:.,_.so> :’ . .. .-.=w>.~z-..~:-«.[...] |
| [...]cessary for plot progression is Stollier, who has a predilection for leather and bondage. Without kno[...]stylish film to look at and listen to. There are a number of striking visual sequences which readily[...]leading up to the murder of Stollier’s wife are a prime example: the carefully- composed image of S[...]Barrie Pattison Fred Schepisi’s Barbarosa is a Even if there is no hur[...]ndary bandit, he Language is one of the film’s It has been said that Western Later, Barbarosa[...]) The The film’s humor, its unfamiliar Why then did a well—made, enter- Mind you, Schepisi is not the first of It is particularly revealing to l[...]y Catholic episode in |
| [...]y the Taiwanese cop more flak in films. Lacking a lobby as effective as the This undeveloped idea recalls the[...]d and bad sides of his nature, simil- ally. They have yet to find a film which Barbarosa[...]eliefs and A shark-caller battles with a shark caught in his hoop. Dennis O’Rourke’s T[...]cember CINEMA PAPERS complex film, which reveals a web of This aspect of the magi[...]d from the Later, there are a few instances of The dramatic nature of[...]ld have been played up for |
| The Sharkcallers of Kontu A Midsummer Night’s Sex Comedy the dramatics[...]from the narrative It is an immense pleasure to see a Sharkcallers of Kontu: Direct[...]Ronin A Midsummer Night’s Sex Margaret Smith W[...]outrageous fortune and The film begs a question: where do When all the visitors descend on the As in Shakespeare’s A Midsummer when we are all variations on o[...]eath, he twists an old classic (Shakes- A Midsummer Night’s Sex Comedy The photography[...], floating ducks, perfectly realized |
| [...]ucks ‘ 1910-1952 THE TRANSPORT SYSTEM WITH A DIFFERENCE THAT . . WILL GET THE MACHINE TO WHERE THE ACTION IS. R[...]‘INVESTORS’ Wanted for ‘THE PERPETRATOR’ a 90 minute suspense |
| [...]d by Simon Wincer, for producer John Sexton, from a screenplay by David Williamson. Clockwise from top: Tommy Woodcock (Tom Burlinson) rides Phar Lap during a morning |
| [...]Publishers Ltd), London, 1982 Hardback, 814 pp., A$45 International Film and TV 36th year Edited by Peter Noble Aa little more than 100 countries. All this is nit-p[...]prone to The two other recent[...]ect than Marketplace, and intimi- sound engineer[...]ce dogs and the pretentious Next is a complete listing of all the Variety’s third recen[...]ze Plays. On the other |
| [...]national and inter- national counterparts to the A ustralian Motion Picture Yearbook. Kemps Interna[...]” to “Zoom fluid If you are a devout reader of, say, So, all in all, if you are in need of The Best Movie Trivia and Quiz Rook Ever Bonanza/Imp., $6.95 (HC) The Best TV Trivia and Quiz Book Ever Bonanza/Imp., $6.95 (HC) A nostalgic look at American television. The Book of TV Lists Gabe Essoe Arlington/Imp., $12.50 (TPB) A great collection of facts, figures and anecdotes[...]by Bob Bruno, illustrated by Marguerite A&W/lmp., $9.75 Clever cartoon comments on famous[...]okbinder A survey of the American films made during the John Kobal Aurum Press/ Dent, $29.95 (HC) A history of lobby posters, includes numerous Great Hollywood Teams Garson Kanin A&R/Angus and Robertson, $12.95 An illustrated sur[...]t Movie Stars — The Golden Years A&R/Angus and Robertson, $14.95 (TPB) A&R/Angus and Robertson, $14.95 (TPB) The second v[...]nson Starlog/Imp., $12.30 (TPB) Third volume in a series of fantasy and science- A complete guide to the science-fiction television[...]len and Unwin/Allen and Unwin Aust., $l9.95 A biography of British actor Michael Wilding. Befo[...]t Touch R. Hale/Imp., $22.50 (HC) Bob Hope: Portrait of a Superstar Fontana/William Colli[...]Wattle/Gordon and Gotch Distributors, $6.95 A well-illustrated coverage of Clint Eastwood’s A well-illustrated coverage of her career.[...] |
| [...]Millerson 192 Small Television Studio - Equipment Ayou . . . However, BILLY “SUPERMAN” SMITH is an extraordinary guy. HE holds the Australian record for a free fall from the height of 52 metres AND ALSOjumps a car travelling towards him at 70 kmh. ‘ ‘So what ’ ’ you say. It ’s been done before. 0. K. So now BILLY[...]and exiblosioes. HE also looks good in front of a camera. I/Vhat BILLY is looking for is a chance to show and use his talents, and wi[...] |
| [...]eer of the screen’s most publicized actress — a most detailed biography. Elizabeth Taylor: Her L[...]i A sensational biography of Liz Taylor. The Films o[...]rmilye Citadel/Davis Publications, $12.75 (TPB) A title in the popular “Citadel” series. New in[...]stein M. Joseph/Thomas Nelson Aust., $4.95 (TPB) A well-illustrated coverage of Bogart’s careers. Iron Eyes — My Life as a Hollywood Indian James Dean — A Portrait Roy Schott Delilah/Hutchinson Group Au[...]Bert Stern Orbis/William Collins, $29.95 (HC) A series of photographs of Marilyn Monroe, An illustrated biography of Chaplin with a Lulu in Hollywood Louise Brookes Hamish Hamilton/Thomas Nelson Aust., $22.50 A Hollywood story — the autobiography of A well-illustrated, in color and black and white, A well-illustrated career coverage. Monroe: A Life in Pictures James Spada and George Zeno Star/Gordon and Gotch Distributors, $5.95 A new paperback edition of ‘long’ interviews with P.S. I Love You: Peter Sellers 1925-1980 Fontana/William Collins, $4.95 A biography of Peter Sellers by his son, assisted A large format illustrated biography with a Ronald Reagan — The Scr[...]Elm Tree Press/Thomas Nelson Aust., $37.50 A biography of C. Aubrey Smith, English Howard Hawks Robin Wood BFI/Gaumont, $15.95 A revised edition of this book originally published[...]cusses the 40 Rosalind Delmar BFI/Gaumont, $7.50 A survey of the work of political filmmaker, Kubrick: Inside a Film Artist ’s Maze Thomas Allen Nelson Indiana University Press/Imp., $16.70 A critical guide to the films of Stanley Kubrick.[...]PHOTOGRAPHS Open seven days a week: Mon-Fri 10.30am Essays by Martin Walsh BFI/Gaumont, $10.65 A collection of articles, some previously unpub- Seven years of film reviewing — a critical view of Orient Longman/1mp., $14.95 (HC) A discussion on Indian films and various aspects RKP/Cambridge University Press, $43.95 (HC) A History of Narrative Film David A. Cook Norton/1mp., $21.30 (TPB) A comprehensive history of the cinema designed A Pictorial History of the Talkies Daniel Blum, re[...]attle/Gordon and Gotch Distributors, $24.95 A year-by-year, fully-illustrated coverage of the Western Films —— A Complete Guide Brian Garfield Atheneum/Imp., $37.50 (HC) A guide to the Westerns screened in the U.S. since[...]s Two Screenplays — Jean Cocteau The Blood of a Poet/The Testament of Orpheus BFI/Gaumont, $8.75 A critical view of television drama through a BFI/Gaumont, $9.35 A discussion of documentary films made for West Sphere/Thomas Nelson Aust., $9.95 (HC) A picture book for young readers of the film A new edition of the Australian classic novel, now $9.95 SUPER-8mm SOUND MOVIES Condensed versions of the top Hollywood productions are available for you to show If] your own home.Titles include: THE R[...]EASE SATURDAY NIGHT FEVER THE FORMULA JAWS Also ava[...]tion lilms specialising in steam trains etc. Also a good range of older lrlms ll'lCIUd|l‘lg To HOME CINEMA CENTRE. PO Box 77, Glenside S A 5065 |
| VIDEOREP LTD. INTEGRATED TELEVISION WORKSHOPS A NON-PROFIT ORGANISATION AIMED AT |
| [...]release hardtops only. (3) Split figures indicate a multiple cinema release. t Not lor publication. but ranking correct. I Box—offIce grosses of indivi[...] |
| [...]Effects Make ~Up for the Industry. —-— R.C.M.A.(U.s.a.) 1 r ' A ’ j f NSW: 8 Qungata Lane, Syd 2000 1 2[...]e. Laedervlllu 6007 Tel: 381 7707 To|ex:AA93625 SAVE A LOAD ON EXCESS FREIGHT CHARGES. -TRIPODS Hi—hats, mounts, etc. ‘W? Del:TR|B:l:o:k,ZrsU:§A:f 3. REDUCTION pkmnuc 'ARR'FLEx 35 ”‘”‘&[...]phone (05) 699 6999 45 DENNY WAY, ALFRED COVE W.A. 6454 Ph 09 330 5070. studio space available 68[...]t your next commercial in Tasmania. We offer from any gauge original full support facilities for mainland crews. cost benefits. DAVID STALEY Ph: 699 4079. Either way, you’ll benefit. By shooting stunning |
| [...]with rubble because of the incredibly high cost. You have to make certain those millions for making a film Are you one who is compelled to Not really. I do this work But I don’t see myself as a priest interesting experience; if so, gr[...]at. present a point of view that may be things, about yourself and about Filmography 1961 Inco[...]* 1962 L’evento* _ at the Centro Sperimentale di Decision of the board: Register (a) Previously shown on May 1982 List. (b) See also[...](G) Conversations with Willard Van Dyke (16mm): A. The Secret of Nlmh: A 8. D Bluth, U.S., 2221.83 in, A Trilogy on Tibet — Part II — Radiating The Fr[...]stralian Film Institute The Weavers, Wasn't That A Time’?: Brown, Stoney & R£attl)rn Of The Soldier: A. Skinner, Britain, 2797.86 rn, The 7 Grandrnasters: Hong HWA lnt Film (HK) Ltd,[...]ln‘ Loose: Universal, U.S., 2537,81 m, Fllmways Croque La Vie: UPCT/Films A2, France, 2880.15m, A Deadly Secret: Shaw Bros, Hong Kong, 2665.00 rn,[...]on: A Midsummer Night's Sex Comedy: Orion, U.S., Axe (reconstructed version) (a): Box Office, U.S., tape): Not shown, ltaly, 94 mins, A,M. Alessl Films & Golden Gate Pa[...]) ll giudlce e[...]andolin PIL, S(f-m—g) (b) Previou[...]Exhibition (R) Alice In Wonderland (videotape) (a): W. Oscc, U.S., 75 Amanda By Night: N. Wescott, U.S., 2194.00 rn, A2 Deletions: 4 me[...]metres (3 secs) Reason for deletions: S(i-h-g) (a) Previously shown on November 1981 List. (b) Pre[...]Woodyard, SpainllN. Germany, |
| [...]amour — is bent on adhering to the maxim: “If you can’t say something nice about a person . . .” She has some trouble accommo- dat[...]ryone in stitches.‘ Dorothy Lamour’s was not a major career It sounds like any number of the characters 580 — December CINE[...]were made in more or was GREGORY PECK, who, without ever being especially interesting, has remained a star for just on 40 years in 50 films. Peck is a star of the same kind as John |
| [...]the Kingdom — but somehow it is all suffused in a rather monotonous haze of decency. The roles may[...]seemed to, and this adequately written account by a reverent hack hardly persuades one otherwise. 0s[...]box-office. As a teenager, from National Velvet (1945), George[...]orge Eastman [Mont- gomery Clift] would kill for a place in the sun with her” (p. 33). Stevens, that i[...]ly seemed aware Kelley has a sure grasp of the high-spots of 15. Kitty Kelley, Eli[...]itled “The Last Star”. the most recent nor the last in a line. Is she Universal features before reaching certifiable As for the career, she has some sense of |
| [...]ftee Shorts — One Act Plays (1) (2) Oh, What A Night! (14 mins, 1932) Excellent Dear Old London (40 mins, 1934) A tourist’s view of Efftee Film Magazine Series; ‘ The “[...]horts Australian Educational Films was formed as a partnership between Thring and naturalist Noel[...]gative held by NFA. Sound Secret[...]The Cliff Dwellers (9 mins, 1933) Life history of a Efftee Contract Advertisements A large number of survives as aa brief item titled Australian Talkies a Fact Melbourne Herald Newsreel No. 21 Released M[...]the basis for Thring’s offer of partnership in -012. Australasian Gazette |
| [...]ion CoIIit’s Inn (1933) — also planned as a film Mother Of Pearl (19[...](1934) Streets of London (1933) — also made as a film The above produced in Melbourne at the Garr[...]e. The “Non-stop Variety” Series These were a re-arrangement of the Efftee Ada Reeve in I Never Forget I'm A Lady (short 24) Lou Vernon — "That’s My ldea Of A Lady” (short 17) Non-stop Variety No. 8 Lou[...]9. This short, now A Midsummer Night’s Sex Comedy (2) Alan Mill in[...](silent). Held by Mill's (3) Now You're Talking (Film Australia, 1978) Compila- I Find Australia, W. Hatfield, Oxford University Press,[...]' Synopsis: A dramatized film about juvenile Camera asstl ri ..[...]Don Anderson u « Film Reviews i[...]of female exploitation in his A Midsummer Night’s Sex Comedy In other ways, A Midsummer “to live a decent life amidst all the junk of contemporary culture — the temptations, the seductions. So how do you keep from selling out?” A Midsummer Night’s Sex Comedy Hopefully, having got A Mid- A Midsummer Night's Sex Comedy: |
| 9 EDITOR ’There’s a new boy on the bloclé . . . : TOM PALANKAY film & sound. editor With 42 yrs experience editing a variety of programs for the A.B.C. he Credited recently for editing A SHIETING DREAMING he is eager to Contact — FRAMELINE FILMS: (03) 592 0108 A. H. (é€;L¢%? 7Z¢Q- The complete 16mm & 35/[...]hin 24 hours JOURNEY To T[_/fig END OF NIGHT at a competitive overall cost. 1982 MELBOURNE FILM FES[...]VIC. 3066 I o§,!:.£Z}o,€l.'£:§s TE LEPHONE: (03) 41 7425 M " John B. Masson & Associates P/L. ~ ->__ 1.‘. A 78-80 Stanley Street, Collingwood’ |
| [...]nderstood from the very start that we were making a film and that what I did, either by action or ina[...]f the film, was about the face: that your face is a mirror of every- thing you have been through, but how terrifying a face you would have to have to reflect all that you have been through. I thought he would take it per[...]erstand it, as being beyond him and being as much a general comment on our faces and the faces we see[...]it is all all right when it is terrible! Why did you reject the idea of I did[...]well dressed. Apparently Film Victoria has given The Australian Film Institute Pat Longmore has a plan to dis- The awa[...]gan- This has had a very serious I Future Plans What films have you in prepara- I have four scripts in various[...]pment. They are all One is a feature film script, Two of the other scripts have The fourth script is a very For which projects have you John Ruane and I have a script Have you that word for word? Yes. I can show it on paper:[...]- | Fil[...]10 mins, col. 1971 Flux 40 mins 1971 Journey to a Broken Heart 50 mins 1972 The Curse o[...]ttin’ the Mutton 17 mins, col. dirlected by Gary Patters[...] |
| 3*“ JANE "% 8 WALKER * O WIDE SCREEN and all PHONE”, AM[...]tering FOOD FOR PLEASURE Production parties A Correspondence Course in Film Lighting? FOOD FOR[...]iting and in Interested? Of course you are! If you'd like details on our Correspondence Courses, or would like a PS You must know by now of our extensive range of training material in print and on film and video tape. If you don’t, you’d SALLY BARTLE, FILMCREWS FREELANCE AGENCY, |
| [...]make one realize that, if taken at too realistic a level, the film becomes either absurd or offen- s[...]t the level of myth. lass of 1984 may be seen as a contrived symbol of the confrontations in our c[...]emotional response. Lincoln High and the Two possibilities are suggested: Corr[...]his lab- In fact, the film is not advocating either poss[...]ome calm. No student is likely to lass of 1984 ra[...]uent deaths. In theory, there is no li[...]on the screen.,Picturing the removal There is a long tradition of stylized, ‘myth- The va[...]outburst. It is also reassur- Class of 1984 is an[...]ver Never and The Little We have used Bett—Bett as a That’s right. You are supposed another culture isn’t going to You seem to prefer a mobile single No, I don’t think so. I think it characters a little more effectively. But long takes do seem to be a It is probably something that I Are you happy with the final I am delight[...] |
| Qllétfifiit (Ear Qlnnmtltantz A H L Support Whether it’s wardrobe[...]ensure that they have the authentic Vehicles for any situation and period. use in films, pr[...]shop illiluhifitatinn SOUND STAGES In a busy production schedule we still have some spare[...]sets seen professional standard. FOR DETAILS[...] |
| [...]- NEGATIVE FILM . FUJICOLOR A TUNGSTEN TYPE Fujicolor A250 high-speed tungsten type color negative film i[...]exposure index of 250 is here! imagine the possibilities. Now you can capture the soft facial features of a coarse grain. All on Fujicolor A250. With an exposure index of 250, it's sure to brighten your day! A Distributed in[...]e, VlC., 3207. Ph: 64-1111. Hindmarsh Avenue, Welland, S.A., 5007. Ph: 46-9031. 169 Campbell Street[...] |
| ‘id al world you would prmt and process a complete fzlm 211 one pass. Soewe do it t[...] |
TXT | |
| [...]Scream Again I'd Rather Be Rich A lice's Adventures in W onderland Cries and W hi[...]Betrayed Guys and Dolls A Man and a Woman Till Death Us Do Part[...]The Trojan Women Boy on a Dolphin Hot Enough for June Mon[...]ffer Hustle There's a Girl in my Soup Z[...]The Great Gatsby Face of a Fugitive Gallipoli The Sto[...]he Family Way Hoodwink A Study in Terror M onty P y th o[...]Lady Stay Dead Ten R illington Place M urder on the Orient Express[...]Lawrence of Arabia A G athering of Eagles Monkey Gri[...]Ginger Meggs Lancelot and Guinevere A Bridge Too Far A Day in the D eath of Joe Egg Dangerous[...]s Talk The Last Hunt 2001: A Space Odyssey Deep in My H eart[...]f the World Thunderball A D oll's House Something W icked (Early Frost) The Little Hut A Touch of Class A Dream of Passion Starstruck Live for Life You O nly Live Twice Eagle in a Cage Breakfast in Paris[...]The Darkroom Lover Come Back A rth u r The Cob[...] |
| [...]The Jolson Story gives you the commitment to quality and the range of The[...]Jonathan Livingston Seagull stock that you demand. The Boyfriend K ell[...]eed negative. French Lieutenant's W om an A Shot in the Dark For Your Eyes O nly Silent Movie W hen you next make a film, ensure you have Gold Slap Sho[...]the world's greatest film maker working with you M ary Q ueen of Scots Soldier Blue[...]n Gun The Exorcist you can see from our list, you'll be in good company. Omen[...]e Wall Valentino All th a t Jazz Vanishing Point H air[...]Tora! M issing Trapeze A irp o rt Travels w ith My A unt A lice's R estaurant The Turning Point A ll th e President's M en The Goodbye Girl[...]mes The Boys in the Band The Prize A M an Called Horse The Professionals A M an for all Seasons Prudence a[...] |
| When they shot `Brideshead Revisited'it w a s... Lights! Camera! AATON! Accla[...] |
| [...]laboratory Colorfilm. Surprising? N ot to us. A fter all, over the years we've been the lab ch[...]ard-winning process all w rapped up. Just take a look at this years winners. A nd by the way, to all the award winners, W[...] |
| [...]hn Seale B a ttle tru c k[...] |
| A rticles and Interviews[...]Solrun Hoaas A Midsummer Night's Sex Comedy[...]ne Sinclair. Office Assistant: publishers accept any liability for loss or damage which may ari[...] |
| [...]has to look at the French for Episode one of a seven-part mini- Ross Dimsey, chief executive[...]contract. Dimsey, who is in presenting any national culture to Honey -- $8000 for Package D[...]ut the world. Maggie clearly sees us as a ment and $20,166 for first-draft funding befo[...]ave Film Victoria, which is to undergo a great effect on how long the British Nation[...]re film industry continues to flicker. appointed a replacement for Dimsey. (For a more detailed report, see Roger Easto[...]ernational, November 13-20, recently spent a month in Australia as a introduced legislation which provides for pp.[...]ents totalling almost $60,000 the Library on a strategy for establishing[...]in the script development of five new a video preservation facility in the In 1976, w[...]te unfair competition with director, said that a continuing flow of recording section. privat[...]in Sydney and once changed so dramatically that a complete professionals and new writers. " If all the worked for a Sydney television station, re-think is called fo[...]ach production," she said, " we have is now a Canadian citizen. One motivating factor has b[...]hildren's Melbourne Festival Sydney, where the Australian Film Com programs." missio[...]Mathews also said the Victorian be a major investor in the South Aus director[...]ions at the Adelaide Festival was able to act as a producer for them. Thiele, and follows Storm[...]and the Sydney Opera House. In 1982, This is a total change of policy, and a Fin. he was a member of the jury at the Mel welcome one.[...]h-risk stage of the program director. Kuttna is a film critic the degree, function and type of gov[...]ny world film ment support of the film industry, a ment -- and then to attract the industry[...]ns are needed to continue lain Sproat, announced a review of the investing in new programs.[...]Film Festival and presenter for A Whole within the industry that the levy may be[...]of Movies on 0/28, has been abolished. There is a feeling that the follows:[...]itted to govern for first-draft funding of a five-part mini Don Dunstan, former Premier of[...]$5644 for final- president of the Festival, a newly- The Association of Independent Pro[...]ucers, has already expressed alarm five for a mini-series to David King.[...]Hamilton: for pilot-script funding for a wildlife[...]ent supports its indigenous film industry. A billboard imagefrom Times Square, New York (The R[...]o keep the British film alive: the Eady Levy, a parafiscal tax that costs the Treasury[...] |
| [...]combining an entertaining live per formance with a popular distribution of[...]It is certainly a problem that needs to awards among many films. B[...]t as they represent the collec implementation of a pre-selection producer o f We o f the N[...]AFI. It does seem odd that a film of the entered down to 18. (For a full report see[...]uld have been allowed to Phillip Adams gave a humorous and win Prize for features, b[...]proved a striking presence in her tradi Journey t[...]n Looking at a video recording later, John B. Murray.[...]however, the presentation seemed a Best Achievement in Direction: Geor[...]Lonely Hearts It is the prerogative of any organiza little lacklustre in spots. Despite e[...]ensive Best Performance by an Actor in a realized the error another ballot was at any time -- especially if a new Louma crane, the camera work and[...]Best Performance by an Actress in a Voters were told to discard the first cour[...]dancers, for example, was a brisk, invig Monkey Grip. problem was th[...]-- : Best Performance by an Actress in a already completed and returned the first A[...]e Best Performance by an Actor in a corrected the errors on the ballot, bent[...]executive directors would have to pay if A second criticism of the presentation Best[...]director opted to pay -- a profit of $30). to Fred Schepisi's unreleased De[...]in Costume Design: nominees were jumbled -- not a serious John Foster and Peter Crayford. Of[...]key voters. these, Brennan was invited as a pro[...]As a result, when the ABC agreed to Best Short Fiction Film: A Most Attrac One Melbourne voter (not myself)[...]d so incensed that his ballot paper had not in a poor light. One hopes that in the films be r[...]e contributions of those who because such a regulation was felt to produced and di[...]Best Experimental Film: The Bridge, changed to a don't know.[...] |
| [...]dsworthy epics, Sunstruck, The Shiralee, Squeeze a Flower, The Australian Fil[...]hem are Daws, Angels of War is a documentary also won two Silver Awards in the same category and a Silver in Commercial Theatre. No unnecessary (e.[...]ced by meeting. Major allocations included a Albie Thoms (02) 969 7468. of the non-st[...]ing the leads and Ducat (carrying a cash prize of 2000 DM) Sealer; and $9358 for A[...]come here. The sort of maintain a satellite relay station on the[...]d press) are determined cover, which received a total of uniformly bad.[...]Stephen Wallace, James Horizon Films' Where East Meets Barbera (Australia), a $2.5 million tele P.S. Let's hope that Tender Me[...]has received a standby finance facility of Barrister Micha[...]a $9350 grant for a 13-week study of speciality will be cont[...]market; and a Trainee Grant of $1500 in support of UAA. The po[...]n o f the Year. 1. UAA has acted within the law, a fact The AFC approved profit-sh[...]included: $75,000 allocated to Naked a for example, has been able to argue[...]nd television. government, dictating what UAA or any other film organization or individual[...]h their or their investors' form of a standby finance facility of president of AS[...]an investors to Careful He Might Hear You. a new executive consisting o f Phillip put money i[...]l-too-vocal Additionally, a grant of $3000 towards James Ricketson, Sophia[...]s. If Australia tralian Movies" (a series of radio produced films as entertaining,[...]r and Andrew Mason received $3972 as a and television industry. It is also workin[...]avel grant to enable him to attend the towards a standard contract that will Maher goes on to[...]ts and grants approved guest-of-honor at a meeting of ASDA Travelling Festival[...]included projects from the Project where he addressed members on the[...]A total of $105,083 was allocated to " If the d[...]credited film and television directors tival -- a division of the Sydney Film City;[...]minal Man. -- The Travelling Film Festival -- is a business name, registered in each state[...]Script and Production Investments Any legal difficulties relating to other[...] |
| Peter McLean A DRAMA OF Adams quite o[...]Pre-production a producer of the film, was at the[...]n Film Corporation when I When did you start work on "We first started the proj[...]cer (Phillip school. It always had a relevance Adams) and associate producer[...]of life in Aus (Brian Rosen). Why was there a tralia.[...]ecome involved? After I'd had a shooting script |
| [...]it were a foreign country.[...]Is that another reason why you[...]Shepparton with a few fibreglass[...]You don't always shoot in studios.[...]There must be a lot of differences[...]control you can have. You are[...]subject to the weather, and you[...]We sort of folk? John joined the production a few weeks before we were due to Yes, you know, people who shoot, and he left perhaps one[...]Why did you decide to shoot in the What caused his resignati[...]worth noting, because we were in the area where took the film grossly over budget.[...]too busy at that time the story actually took place, and[...]of distance. It directing the film. However, for a because we did, as individuals, One of the complaints that Dan, a should be possible to organize a producer like John, it may have experien[...]ct and that I experienced. It certainly had a understand the outback, like[...]the cast, just to telling bush stories. Do you think planning. don't know and I don't think it be in the same place and to walk that the 12 weeks out there put you would be proper of me to make the same ground. Some of them in a better position to understand Screen Adaptat[...]t the book was about? with discussions that took place others.[...]hough I had spent limitations of adapting a screen and John just before he left the It is not easy working like that, quite a lot of time there in the years play from an autobiography? production. Quite a number of obviously, but I think it is[...]shooting. My job at the time was weeks and you can live through 12[...], not being totally familiar weeks under almost any hardships. It is a special part of the world. the limitations are[...]erhaps one of the film's strengths It has a spiritual quality. I think particularly when adapting a going. is that[...]insanity about it. You sound a little circumspect. . .[...]were there. Transport costs had questions that you sort of folk ask. been underestimated,[...] |
| [...]more successful about her position as a married Never Never. Obviously, we had to o[...]e aware of the possibility of that she is a rebel of some sort. it as a period story. severe criticism for damaging a Obviously, it provides a contrast[...]lm? escape that, I don't know. gives a context for the rest of the and Aeneas (Arthur D[...]written in the first ally restrained. How do you create table with the two or three scenes intent of the book, and I believe we person. Did you ever consider a feeling of intimacy between a between husband and wife that have been. Perhaps some people using Jeannie as a narrator? couple who talk so little about aren't in the book, because they won't quite see it lik[...]from her family in Melbourne. Do you see any similarity between[...]films like "We of the Never What did you think its intention But it wasn't really a story of Never" and "The Man From was?[...]marriage was a catalyst for the Western in terms of[...]I thought her reticence in writing a comment I heard quite often[...]about emotions and feelings was a from distributors in North[...]embarked on for a new form of[...]a year and a half after they were They identified[...]forms nowadays are a reflection of I think Jeannie Gunn's inten[...]ern Territory. That exploration becomes almost a I thi[...]he book to be an Why did you decide to include the Do you think it shows a contrast |
| [...]we were searching for some slightly they see a Western form that before the me[...]d cynicism. film you get the feeling that she is warm, open, contemp[...]tionship. It remains reserved and make a film because it was There seems to me to be a common[...]ing that's Australian today. prove your worth in a harsh society. She was expected to be a which are crucial to Jeannie's Frank[...]as a woman whose place is in the character charted in the book. Th[...]that the men built the house as a[...]place. It accentuates her resent[...]The film needed a forward-moving[...]and even a bit neurotic . . .[...]would hope that it is not a ridi[...]A film can only possibly deal[...]with a very small section of a year[...]in the life of a cattle station. Some[...]times we couldn't find the approp[...]th the arrival of I had trouble with the scene where feverish stranger, and Aeneas takes the s[...]e others woman and they had pre-concep a demonstration of the bonds of desire to te[...]ere and two days before the There seems to be a stronger feeling male world. Why did you change proceeds to bribe Goggle-Eye nati[...]book. You feel that she under[...]and teach Bett-Bett (Sibina Willy) It is a reality in those sorts of stands the me[...]We tried to describe something to eat with a fork . . . environments, even today, that[...]she didn't describe. We tried to unless you are competent you are a look at the events and suppose a Exactly. I am delighted you had liability. The men expected Aeneas[...]moments and attitudes as some background. He was a strange them or that they don't[...]ad to work through for character: an adventurer, a geo her. Towards the end of the fi[...]events in the book. She herself. She was a city bred, grapher, a romantic, a seafarer, a the attempt at comfort that she[...]lady with no special librarian -- everything but a cattle receives from Dandy (John[...]the book. We just other cultures. She had a certain[...]rk through her response emotional response to a situation, What about Jeannie's comment[...]and believed that all human beings that she's a wallflower? You get a took in the script was more[...]is to rather than to teach. than the book of a woman who is between the whites an[...]accepting Yet, when it actually comes to a[...]w to do that, in the The concept of herself as a wall One of Jeannie's major criticism[...]express their emotions to a I would argue that the reactions[...]letters from the Northern woman. Do you think Dandy's we gave her are reasonab[...]dian gardening tasks for Territory to Melbourne, where she her influence on them?[...]As a character she is by no wallflower. 508[...] |
| [...]it to depict atti their own. We wanted a device that I assume that through a whole does cause problems. Later in the tud[...]riginal people have their own without having a literal time scale, vention, but we have to see[...]their own sense of it is possible to convey a sense of before it is worth questioning.[...]I can't tell anymore. Do you their own sensitivity. I would[...]at the end believe that the film takes a racist suggest that that thought probably supposed to indicate a resolution or a non-racist stand? hasn't occurred to many urban Perhaps our definitions aren't of problems? Australians. But a film as broad as exactly matching. I consider t[...]We of the Never Never, describing unless you do fully explain and It is an indication of a[...]ny events, must trivialize fully follow up, you have trivial by some of the members of the and subordinates. Jeannie holds a most of them, unfortunately. ized the importance of something. group, a desire for contact. But different view at t[...]intervenes, finds that her actions If you must trivialize events, what should probably ru[...]are only causing conflict, and then are you hoping to convey with the three weeks solid a[...]s that Why is it necessary for them to get You don't believe that there is Well, you hope the moments we tried to indicate. up in the middle of the ceremony any advance towards a third form that you indicate are real and true. and start shooting?[...]But they are not very deep A film obviously isn't a defin pri[...]tions of the moments -- itive statement of any sort. It is an As their form of expression of[...]one of the things that this film, but in any film. You are hopefully an emotional and people of the time. I think that is a perhaps the film ultimately says is looking at a broad time scale; you moving idea, but it is not a fairly accurate representation of that it i[...]would suppose it is unresolved events you select. You can't tion. All we hoped to be able to[...]e understanding that adequately, can you? How did the Aboriginal actors i[...]have no answers, only questions. husband as a couple, and, through[...]tribute in any way to the creation Occasionally the book is qui[...]of black and white to any great[...]acter? She is a peripheral character[...]in the book, but a central one in[...]uyul Yanthalawuy) and Jeannie. Top ordinate. Did you choose that right: Rosie, Jeannie and fr[...](Sibina Willy) and Jeannie. We of It is not a change we made. That the Never Never. |
| [...]to the creative use of his critical faculty and a commercial deployment of his Calvinism. The result is a body of work that is a bracing commentary on classic and modern[...]People (1982), the curator as a romantic idealist in search of[...]other way, it looks like a characteristic Michael Courtland (Cliff R[...]Obsession (1976), who is also a romantic Gallier (Nastassia Kinski), is both a preodbasteosrsive, a man who kills the thing he loves and a victim of her own nature, and, as such, and then builds a shrine for her. In Obsession,[...]core compared because of their imaginative use of a (1979), the viole[...]repression. In Cat People, when a young keeper drama, and their concern with the taboo of is attacked by a black leopard, there is a shot of incest which in both films traumatically[...]visually implying a link between feline ferocity preserve the charact[...]s films, Cat time you tell yourself it's love. But it isn't. It's[...]y is despoiling a vision of perfection. The character used also as a correlative to human savagery[...]ltimate descent into the society now that there's a monster lurking[...] |
| [...]ector Paul Schrader and erect against a brick wall. actress N[...]rts Julian Kay (Richard sion. Similarly, just as a Schrader character Gere) in American Gigolo;[...]d arm in Cat purification and perversion. I am a little People; the most sickening broken nose in[...]One of the shadowy and rat-like, he is a will fixed and dubious achievements of Cat People is to give a gripped like a trap. He is not nice." whole new dimension to th[...]iver hero and his description imminent presence. A hand becomes part of the of him as a man " who moves through the city garbage in Rolling Thunder. The demented like a rat through a sewer" . desire of Travis Bickle (Robert De Niro[...]rk by practical Schrader might be called a junk-food action, rather than by political persu[...]ion to and purify becomes indistinguishable from a massive psychological dramas about self- d[...]between heaven and hell, and who find One should be wary of identifying Schrader[...]here sometimes is an uneasy sense of his putting a The ultimate dramatic goal is rarely a sentiment he is afraid to acknowledge within narrative resolution but invariably a form of himself into the mouth of an unbalanced[...]of American Gigolo. " One Travis in Taxi Driver a madman or a hero? Cat thing I know that, whereas I was bl[...]titillation, the ambiguous closing scene where Jake talks to[...] |
| [...]s the instant feeds off previous films and offers a modern People as if it were a shrine, and, as the cat stares back, the David B[...]ise: " He's perspective on earlier film classics, a form of lyric: " I could stare for a thousand years, and don't you feel my blood enraged."[...]adaptation that is also a form of criticism. This All four films conclude with a movement into Schrader is also from UC[...]ut there on the decided not to become a minister, he took up a parallelism with variations, expansion and Cat People is something of a departure from character, spiritualit[...]lor, sound and performance, evoke the essence of films as a dimension of Driver gives the answer to this: a European Bujold), the mirror-image of the woman cameo as Dr Hoffman, a stuffy, small-town psychiatrist with a disdain for West Coast morality (he even pronounces Los Angeles as "Loss Angeles" ). When a worker in Blue Collar (1978) launches a one-man attack with a forklift on a recalcitrant vending machine, the excessive[...]rversion and pornography of Hardcore, there is a funny moment when a 512 -- December CINEMA PAPERS |
| [...]Niro) talks to his `Debbie', Iris The search fo r a lost daughter: Jake looks at a porno film similar to those of Ethan and Scar in[...]racist issues his wife and daughter, but, after a remorseful Driver and Rolling Thunder, like The[...]that the earlier film elided, Taxi Driver is also a[...]n the efficacy of heroism, 16 years, he is given a second chance to redeem Searchers, have psychotic[...]ch Ford's films himself through his reunion with a daughter onists are nightmare images of their own[...]ord, in The Searchers, is profoundly who is also a surrogate wife figure. Destruction undisclosed wi[...]ves way to renewal: dam nation to revenge becomes a kind of terrible purgation.[...]Waterfront. Schrader's debut as writer and been a compelling addition, but the film still is he has[...]references to Elia Kazan's film, culminating in a remarkable celebration of Hitchcockian Rolling Th[...]onfront this issue a verbal confrontation between Jerry Bartowski[...]Pryor) that is almost word for word a repeat of[...]observation of shop-floor politics, Obsession is a critical work of interpretative he was prevented[...]is suffocated in a haze of blue paint spray) and insight and not bl[...]film takes implicitly throws the compensation and a re-enactment of a personal[...]he sees as a specifically Marxist conclusion. The romantic an[...]boys, the old against the young, the black A nother key film from the same Flynn's direction softening Charles into a nice against the white, to keep us in our place." period, to which Schrader's wo[...]rs (1956). Four the character in Taxi Driver a dog" , Schrader[...]has said), Rolling Thunder now looks less like a Jake La Motta reci[...]film about a racist than a racist film. Malloy's famous speech: " You[...]had class. I could have been a contender." Both[...]redemption and who have a relationship with a Yakuza takes from The Searchers the idea of a Taxi Driver is more uncompromising.[...]hemselves but hero's quest in an alien world for a kidnapped It includes a tender scene between representing a desired vision of genteel woman[...]arvey Keitel) and the hood, a sense of softness in a hard world. Both girl, a quest which is also a form of self-interro heroes have a love-hate relationship with their gation. Howeve[...]Foster), which is the equivalent of a ought to have looked after them bet[...]ften imagined in The Searchers but world to save a girl from what they perceive as never shown: the[...]erences between the two heroes the lower depths: a rescue mission that is also a Brandon) and Debbie (Natalie Wood). Was it[...]ervy confrontations between 8. Donald Spoto, The A rt o f Alfred Hitchcock, W. H.[...]ot dis Allen, London, 1977. Three images o f "a blond heroine classier than themselves but representing a desired vision o f genteel womanhood, a sense o f softness in a hard world": Travis and Betsy (Cybill |
| [...]ront and their examination of an actual a critical essay on the changing fashions of reacti[...]reflecting horror, demonology and script). He did a first draft of Close Encounters the essential ro[...]r so. Brando's hero represents the confusions of a typical rebel of[...]the alienated anti- hero of the '70s. Brando is a rebel without a[...]d Scorsese's floating yellow taxi cause; De Niro a rebel without a brain. Brando's solution to what he sees as corr[...]ily conventional part of it. Indeed, any critical history of Encounters) as the two most r[...]of the so-called Hollywood renaissance challenge any attempt at identification or moral less fl[...]Scorsese's febrile Catholicism to approval. (As a British critic observed, Raging figures o[...]e Palma to the Utopian Hates Me." ) They reflect a contemporary for The Yakuza) and Tewkesbury (who gave a fantasies of Spielberg. Schrader looks like a confusion and scepticism about heroism and[...]his achievement to date? Is there still If a film such as Raging Bull can be read as a sense of a vacuum between the quality of his 514 -- D[...] |
| [...]who, professing to be a clinical psychologist,[...]is greatest gift is precisely this dresses a retarded young man in his dead[...]sion, or whether an adult film about a yearning[...]whether it would work for anyone else. It is a a regular film critic and instead[...]wrote a screenplay. Schrader has[...]gift more appropriate to an imagist poet than a always been materially ambitious[...]development, and the willingly into a commercial straitjacket. He has[...]ormula (like, for example, the glib attribution a line in Obsession when the daughter,[...]live. " It's a little late for existential questions, 'cage'. T[...]Hardcore has a brilliant premise. George C. darling" , sh[...]money. Believe me, it'll help you to forget." Scott's star persona as a crusader against the That is the question mar[...]t too late for him to return to the the diary of a madman. Blue Collar also avoids[...]ur. translate these into a dramatically-convincing 1976 Obsession.[...]ient. This is mid-section, where VanDorn poses as a trendy Director something which also disfi[...]nd fearfully unconvincing on any level. Negroes, not to mention gay Negroes.[...]the new morality, the film looks like a porno 1982 Cat People. he encoura[...]Town. his life at that moment and then find a dramatic metaphor that corresponds[...]diversion of a caper film plot. American Gigolo to that emotion[...]tionship with the politician's wife. metaphor of a taxi driver cut off from human Old Boyfriends has a promising concept contact by the glass. It exp[...]der's -- the revaluation of one's present through a (taxi driver, gigolo) and a symbolic function in former boyfriends rather tha[...]friends? (The obvious answer would be that it a symbol of urban alienation, gigolo as icon[...] |
| [...]to find government funding has not, as it has with others[...]There is a wealth of meanings and nuances.[...]get, usually on the basis that the filmmakers and any other personnel involved are[...]There is a certain irony, then, that what is described as in[...]t'. Without the private means not only to finance a film project but beyond that to buy up a few cinemas in which to show the film, or at the very least a[...]ase of Tammer, the fact that he has operated with a measure of self-inflicted[...]n notions of film form. It is safe to say that as a result of[...]I would not count him as a `natural' filmmaker. His methods do not have any smooth[...]e. At their best and most effective, they rely on a sense of shock that[...]is always a frontal attack.[...]work to have a broad public impact mostly through extravagant pr[...]Overseas film festivals are now showing interest. A breakthrough[...] |
| Above: Peter Tammer. Below, top to In the films you made through the You have called this form of work themselves the[...]Mallacoota 1960s and early 1970s there is a "portrait films" , making a distinc qualities they don't. T h at's[...]show at the pub; out one common thing is that you have mentary or `biogs'. How do you swimming; Michelle and Larry in the motel chose[...]ion? Now, how much one pushes a scene; Debbie (Debbie Conway) and her way e[...]ne of the do with the aims and purpose of a dad (Tom Pye) discuss her leaving home. Eccentric is a bad word because aspects of documentary.[...]it is prejudicial; it has a feeling of loosely be called bio-pics or biog[...]somebody being a nut. I don't but the normal understa[...]or Reg Robinson that way. public note. You might get a film[...]Edith Sitwell or a documentary on sense of having a story to tell. He The only time I have made a film the life and work of Orson Welles,[...]about a real oddball was Danny including an i[...]eccentric so much as a guy who[...]l had a freaky unpredictability, to Now, mine[...]y portraits. things like, " Okay, let's set up a which[...]ve elements of documenta scene now. I want you to talk[...]television documentary of your mates that you might know[...]ortraits, which always, to my from parade a couple of weeks ago[...]anny being in only one knowledge, include a narrator. and just down the trail two day[...]here are very few films in the bio- ago. I want you to live through[...]What attracts you to your selves. The filmmaker mo[...]I don't have a rule. I don't look[...]fifth a person who has some remarkable brothers established a trust with takes.[...]lutely staggering, last take in the film, where Bill[...]example, I was very conscious absence of a voice of God dictating day before. In that sce[...]when making Here's to You Mr the sort of things that the audience one whole evening doing what is a Robin[...]we were also making a portrait of left total freedom to pick u[...]d it. We That is true of Here's to You Mr I was scared of how far I was[...]commercial film establishment in a cinema verite school, and there has himself in a trance, which he conventional sense. I am an inde been a lot of discussion about hadn't done in th[...]the your films, one suspects there is a approach with the Danny Boy[...]" Struttin' the Mutton" , for That was a oncer.[...]t outrageous performance going on You started making films literally[...]and not as part of a general[...]try scene. There is a great difference[...]with standards mance encouraged by me as a film the level that I want to make films[...]s. 1. A Woman of Our Time, Here's to You Ma[...]Robinson and Journey to the End of I take as a basic departure that most expensive film I hav[...]natural in front of a camera. They for 60 minutes. I put up $18,000[...]will not only reveal qualities about and got a $2000 Creative Develop[...] |
| [...]down to home movies like So, yes, it was a conscious deci Kirsty (Kirsty Grant) in debate[...]at Swinburne, Kirsty Grant had a Stampede dramatic[...]commercials but no other screen life as a documentary? acting at that stag[...]Of course, Wanda and Michelle, meant to be a mixture of styles. the two drag queens, ha[...]f doing it, or audience, but had never acted in a a two-year-old kid pushing his film. She didn't know how to do father off a sandbank in a canoe. things actors would know how to Som[...]ond level was meant to measure and deliver a perfor be a narrative structure in which mance, hit cue[...]ilm actors, I had to modify the were written and a full cast was direction and performances t[...]problems, we didn't get as many tried to find the action as it was scenes shot as we intended.[...]ing, hoping that there were have completed it in a more not too many continuity errors.[...]n feature wanted the actors to get into a length, had 1 money to go back wind-up[...]efore everyone Unless it was budget, why did you disbanded. choose to film like that? Then there was a third level, Partly because I like to make |
| [...]. every event that he takes you believe I could still make my style[...]htness they want. audience, which is at a loss to that it hasn't changed too ra[...]haracters in the same style as Bill Can there be a confusion between[...]those events been tested beyond the normal you, naturally, and what a profes memorial was strictly fictional,[...]do by the nature though I regard it as having a fic and clarity, some have receded and[...]raining? tional quality. In a sense it is rep taken on a sort of misty quality. with it in different[...]d to Now, I see Job's way, the inated if a professional actor were walking around the hou[...]What gives the film its interest is a both. But, then, all are similar at able thing[...]at work some level. They are all basically you as against what doesn't. What fictional, but they have a validity. where truth and reality and fiction asking, " What[...]in his mind. Even if getting up in you are probably right to call it a the night has a representational portrait film . . . shit, this veil of tears?" They all A war-time photograph o f Neave.[...]Bill Neave sets a charge during the war in Neave as seen in Journe[...]because he believed that God was a of Night[...]new realities and any good film, more inclined towards Celine's[...]One is more documentary than any film that I respect, challenges atheism and h[...]told. I the other. The pills in the night is a me on a multiplicity of levels in this world tak[...]oncentrate on representational attempt to place a including the things you have just nightmares beyond comprehen how i[...]rein does sion. They have no meaning, no a number of dichotomies in this memorial was a fiction in a sense the power or truth of a film lie. justification. film. First, you have to stop and because I don't believe Bill had consider how much of what ever been to the memorial at night, Frances[...]According to Celine, we are happens is a performance for the until that night. I ask[...]ance, have haunted me from going through a terrible existence camera and how much of it is a it because I know that he has been the times I have seen them. In a which is difficult for us to ^under deeply felt experience that you just unable to come to terms with 40[...]ars of insomnia and guilt. The made in a feature mode, but they honest about that and acknow starts with a sequence which to me only way I could represe[...]tions. Why limit them and call ness appears a man in his pyjamas, them either a feature film or a Someone like Bill takes the other who[...]empting to rep documentary? They are a approach and says, " I can't unde[...]slowly the man starts reliving Is there a distinction in the film spersed througho[...]n memories . . . between a sort of objective truth obviously provi[...]been and a truth that comes out of this tary on Bil[...]ecreation of what Bill Neave has But do you see them as more than and become a murderer?" Celine instantaneously relives the me[...]" It is normal, mate! It's just ories. There is a scene with his wife[...]alking about putting bets The whole film is a recreation. They are meant to have a mul on the races. Then it goes straight[...]tiple function. The first level was You would obviously reject the[...]out of his mind and we events into a separate relief. There the quotes are simply p[...]ve no idea about the truth of are, as you know, two separate sets pretentious . . .[...]from Celine's Journey to There has been a good string of[...]know what you think about it, we[...]them a view of relief from the story[...]that would throw it into a wider[...]context, a historical, universal per[...]a level of their own cultural exper[...] |
| Chris Long Where should film many[...]the start exhibition quota specified a minimum of[...]should be made with per program. A newsreel and a short could fill[...]Andrew Pike's excellent magnum opus, A us Director Raymond Longford provides a P robably the largest body of undocu[...]Efftee Film Studios in Melbourne. |
| [...]each film. In several cases, during a search[...]ma is quite possible that a thorough investigation[...]of the cans of Efftee nitrate could reveal a phobic, seldom moving outdoors.[...]occasionally is Until a thorough documentation of Austra value as record[...]documentaries and shorts, any analysis of the matic quality, a high technical and artistic " sussos" scratching[...]most of the films -- and particu Ballarat, or by a brief shot of a Fascist march in the films themsel[...]ese are derived from censorship records. In with a modern audience. Noel M[...]ures, already published in Cooper and Pike's are a home-grown equivalent of Hollywood's partnership[...]934), of porized by Monkman. Even today, they are a[...]ck O'Hagan, the Efftee material are all too often a sad[...]A Co-respondent's Course Keith Desmond, Athol Tier[...](44 mins, rel. 6/11/31) P.C.: Efftee. Dir.: E. A. Diettrich- and Harry Jacobs' Orchestra. Efftee[...]Minchin, Donalda Warne. provided a convenient means for cinema prints have impeccabl[...]ularly true in Regent Theatre Orchestra short has a virtually The Haunted Barn country areas, where cinema patrons had little unlistenable soundtrack[...](43 mins, rel. 28/11/31) P.C.: Efftee. Dir.: E. A. Diettrich- opportunity to attend good legitim[...]und films were Their survival alone makes them a priceless and shot to a square frame, or pre-Academy unique record of[...]re badly on their cinematic excellence to draw a crowd, cropped at top and bottom, destroying t[...]o Hanna's films are particularly difficult for a `modified silent format' reduction specifica m[...]held by the NFA, so the job Efftee films all reflect a rather naive With the acquisition of se[...]asnt Apollo Granforte operatic item, dreams of a better life in Clara Gibbings and have not been c[...]ns con escapist element is evident, presenting a taining the original nitrates are mostly l[...] |
| [...]r " Dr. Mac" , Talkie adaptation of C. J. Dennis poem, starring Cecil Riff Song" and " On[...]sings " That's My Idea Of A Lady" . Scott and Ray Fisher. N.B.: the NFA has[...]1931) Pioneer broadcaster O'Hagan sings a (4 mins, 1932) A character actress in panto and His Royal Highnes[...]ng " Carry Gilbert & Sullivan, and later a classical singer of[...]d To through these shorts. It is a great puzzle that Thring Lavish musical comedy o[...]lms. She sings who dreams that he is the king of a small European[...]piano playing a selection of ballads and light (4 m[...]) (3 mins, 1932) Bornstein plays a selection of classical items,[...]1931) Desmond recites the poem On The Stairs in with Henri Penn pro[...]1931) This short exists at the NFA only as a picture issue of Everyone's, March 1932. starring Pat Hanna. A sequel to Diggers. ne[...]Wallace as a star comic for his later features. F[...]the early 1930s, giving acting classes. Later A Ticket In Tatts[...]Herme Barton leads a corps-de-ballet of dancing roles in[...]ght 1932) Sings " I Never Forget I'm A Lady" with (unfinished feature, in production at end of 1933) P.C.: To Be A Moonlight Saving Time" .[...]bs' Orchestra. Efftee. Dir.: F. W. Thring. About a third of this film was completed before producti[...]singing " A Couple Of Ducks" and Maurice (28) Wi[...]Maurice Chevalier singing " You Brought A New Conducted by Wando Aldrovandi.[...]s produced on stage by Thring at the end of 1933. A (15) The Sundowners -- Harmony Quartette[...]J. C. Williamson 1932 production was suspended. A six-minute sound test of 3LO with[...]Aldrovandi. While The Stars Are Shining" , with a spoken introduction Told Her, She Hasn'[...]empt at an Australian equivalent of The Birth Of A Nation. Stars Peggy Maguire and Franklyn[...] |
| Liliana Cavani, like compatriot Lina Wertmuller, is a controversial director. N ot only have he[...] |
| After graduating with a degree in because we were dealing with Saint[...]cs at the University of Francis. I chose a modern young story of a woman who had been Bologna, you attended the Centro man who didn't fit in w[...]hat of every these people, the asylum becomes a courses were properly designed young per[...]m and that of Now they have closed down a lot very stupid in the years around my ge[...]t young people in Galileo grew out of a co-produc open the gates. successive years were deprived of a tion between a private network and school. It was the only one[...]and Tibetan poet, Milarepa, which I there is a cinema section, but not in studios in Sofia. The[...]nt to show it because it con the story of a young person who courses in the performing arts,[...]There were a lot of problems The Centro Sperimentale was[...]doing Galileo I had to Sometimes reading a book does very practical: at the end of the depict Galileo against the church this to you: it is like experiencing first year you did a 15-minute film, and the church against Galileo.[...]g itself, or being at the end of the second year a Remember that only three years taken on a voyage. I simply wanted 30-minute film and so on. You ago they took his books off the t[...]to use lenses, to edit, etc. black list. But I find the polemics experience with a different culture[...]I made it for television on a low destroyed, and hopefully they will[...]works with projects like this. They Do you think you would have gone The Cannibals was someth[...]ivate was a desire to modify and above networks clearly[...]uch films; they cost more than worthless, unless you want to things -- a search for the meaning they make. So I did it with the make a career in the public service of existence. The Cannibals was a RAI. or as a functionary. No one has version, shall we say, of Antigone, ever asked me about my degree. set in a contemporary ambience -- Galileo, The. Gu[...]and Milarepa were filmed on I applied for a post as a func departure.[...]results are superior. I cannot bear them on a freelance basis. One was Italian problem, but terrorism is a when people use 16mm and blow it The Story of[...]newspapers are full of them and It is a swindle; it is not right.[...]rom there, I went on to do cinema, unless you have certain It is fair enough to say t[...]L 'ospite (The Guest, has to be a minimum of profes that interested me and about t[...]the Host) ization. You can't just rely on the did a story about Stalinism, and an moral content; you also have to inquiry about urbanization. I was The Guest, the Host is a film I produce something that is well very i[...]had made worked on many programs of this a great impression on me. I went The techn[...]emely nature until 1965. for a week to observe and make important to me,[...]notes. I wanted to do a story about cinema has lagged behind in this Francesco d*Assisi a woman who lived there for many area. For th[...]ey In those days, the asylums were you have to go through death wanted to do it in the[...]" No, I want to sarily raving mad, but who were a done properly. Advanced tech do it on 16mm[...]it nutty and an annoyance for the niques cost a lot of money; you the street, not professional actors family. S[...]Often they could not this because I already had a adapt to life, perhaps because they[...]ers; Max and Lucia; Lucia. Liliana I did have a bit of trouble[...] |
| In Italy, the critics don't help at all. The more `poor' a film is, the more they go for it; it is ludicrou[...]For example, if you make a film about the war, you have to talk There was one woman who said[...]o Dachau, two films which talk about war, where she had been a prisoner, for her holidays. This made a strong The Night Porter and The Skin,[...]on me. I would prefer which treat it in a manner contrary to go on holidays to Hawaii,[...]nly not Dachau. But she enjoy giving a history lesson along experienced very intense se[...]ering. I something, I want to do so in a don't know. The human psyche is diffe[...]way, you come to understand them There was another wom[...]lan, who, when she returned home after surviving a camp, was I grew up in the post-war[...]ening to what people said then, treated her like a poor wretch. It you would ask yourself: well who got to the stage where she couldn't was a Fascist in Italy? Nobody! stand her friends and[...]e depths spaceships, back into the sky. You of human nature. We always think ask yourself: how is this possible? of this as a positive thing, because we look for the better side. In fact, you were not allowed to However, she ascertained wha[...]thers. She said, " The of them had rolled a big rock over physical suffering passes; this it. And then you come to discover won't ever go away." certain things, s[...]Italians -- in fact, nearly all A story slowly evolved from all this, a story of the things that Italians -- ha[...]ally happened. War does not just Fascism. You start to see things as occur, it changes people.[...]d of people to feel had been told to you. My genera important, to feel that they are[...]n some way. So the moment he can be developed to a maximum or can put on a black uniform and remain at a minimum. The ordi nary filmgoer understood this[...]he found something in it He feels like a big man. which, to an extent, he lives.[...]the critics are used to seeing, those who had a problem. To and love to see, things with which they are familiar. And, if it is a make a career in the university, for woman who has made the film, and she has presented things in a example, you had to be a card- manner to which they are not[...]as had Dominique Sanda and Robert Powell during a break in filming o f Beyond Good all the[...] |
| suddenly there was a mass of them. homosexuals in the head, even i[...]en and the children Did things become easier for you wouldn't encounter any more who put things back together aft[...]ted. when you look around, you see Indubitably. The film was very there[...]d of never asked if it wants the war or A l di la del bene e del State, but n[...]yond Good and Americans all talk a lot but they Sure, there are lots of other s[...]t was are a bunch of fops. important to me[...]women have a more difficult life far more educational.[...]is born prac -- especially in the north, where I tically all modern challenging and come fr[...]y modern: Lou men are capable of killing a Camorra [Neapolitan Mafia] was was the blonde creature of which woman if she has a lover. But you involved and it was practically like he had[...]have to understand the context. It a war breaking out. Last year pendent. She no longer had that is part of a game. I am not saying alone, there were 187 deaths from 1800 type of female behaviour; that you should kill -- on the con this `civil war', much more than more than a feminist, she was trary -- but it is imp[...]ready simply herself. He pushes the thing as a whole. Naples. So why should we[...]is worse? Your heroines are similar: Lucia a very provocative way and with (Charlotte Ramplin[...]negative preconceptions, in order Do you always collaborate on a Night Porter" and Lou (Domi to speak[...]eyond Good she got there, she understood a lot and Evil" are slim, self-assured of things, much of which was con If I were offered a screenplay[...]s to stop at their am not interested in relating a own experience. One can say, " I[...]one films story about the dolly-like heroine. find it annoying that a man based on stories written by me or I don't find these women physi pinches me on the bum" , and of with a collaborator or, as in the cally interesting, ei[...]erfectly right. It is case of The Skin, based on a story an awful, masculine, roosterish taken from a book, but again with Actually, the Italian ce[...]ove. You have been quoted as saying It was the first film[...]that the images are more important any rate -- with `her' on top and[...]occupation of Naples. I think that thing you can without words. The have to wait until it is[...][author of La pelle], not literature. being a woman influenced your like everybody else, was a Fascist career? and then became a Communist. Of course, dialogue can be[...]extremely important. But I believe are any better for women in the it is better that a scene has as little U.S. than they are in Italy.[...]ogue as possible. Naturally, if contrary, due to a strange cultural you are making a film about a trial contradiction, in the Latin then there has to be a lot of countries women are more res[...]important. Sure in Italy when a woman[...]ive an impression. |
| [...]E several, good-sized shelves in any performing arts |
| [...]Toland catching the upturned face in a way that tion has provoked both nostalgia and the urge reason, you k n o w . . . " soft[...]es such as publishers, Film stars are so much a phenomenon of a On the basis of the nearly 20 vol[...]ered away my youth in recent producer recognizes a saleable commodity, months, I would find it hard to adduce evidence The[...]ns to market it, stars for no reason, you know. They're stars public, now[...]It seems to me that the public still reaches to any given star apart from a seductive the chief recurring elements of these works is out to any actor who is even half-way towards physical pres[...]creen than on the point of being offered any role in a film Jane Fonda, Warren Beatty o[...]ich is at once more exposed to the takes a degree of persistence allied crucially to a cess of On Golden Pond suggests, towar[...]screen Having achieved not merely any role but the But the passing of[...]way of, say, intelligence, under to be a star -- it is equally clear that an[...]into play new role as part of a business deal; a decreasing much harder to assess and to attribut[...]to sustain that privileged position. Even a pro willingness of newer actors t[...]ves gratifica private lives (even a diluted or sugared version) This being so, it[...]never gone anywhere else since" (p. 57). A the public which both make a cult of old stars sensitivity we have admired as[...]el, her way to the roles that made her a star, and, these are a few guesses about the reasons for the belong els[...]imposing, seeking turn out for a Star Wars but not for a star turn. 1. Stewart Granger, Sparks Fly Upwa[...]Before I Forget, Hamish Hamilton, To know you are a film star is, presumably, 1981.[...]world want to watch you both being recog 3. Shelley Winters, Shelley --[...]81. called film acting. It is a heady thought no[...]families, education, religion or any other of the here have notched up s[...]are encouraged by those with a financial abruptly, `and I[...], spouses and others striking a moral pose about this -- is markedly[...]universal an icon as a film star is makes prepos marriage[...]Jess Barker, " The son of a bitch hit me" , to the[...]aspect of cinema) is a product of a more or less weren't going to b[...]makes a star, the public knows one when it sees easy to write about a succession of liaisons, one.6 At the moment there aren't many to see: with and without t[...]etc., and one something of a bind here: on the one hand, they[...]woman -- Streisand). This is a black night may wish to present their subjects as a moral' indeed when you think of how many stars m[...]glittered on the mid-'40s payroll of any one of Calcutta; on the other, they are aware that a[...]breath -- or better, a gust -- of scandal will[...]5. Charles Higham, Bette: A Biography o f Bette Davis, 9. Henry Fond[...]ment Award 10. Christopher P. Anderson, A Star, Is a Star, Is a Star![...]public -- knew exactly who was to get a standing The Life and Loves[...] |
| [...]y Winters has decided to let it all hang out and a very repulsive spectacle it makes; James Mason has opted for such discretion that it comes as a surprise to find him named as a co-respondent in Roy and Pamela Kellino's divorce or to find, 11. Claire B[...] |
| [...]ing to the star century. But, with the backing of a shrewd and crisp honesty and common sense. Hig[...]years prevented her from achieving fulfilment in a variously, Mildred, Regina Giddons or Marg[...]was ruling the maintenance of a star career was getting fighting[...]sexual ambidexterity, is in fact a surprisingly publicity but which parts the contract |
| [...]T op left: L ee M a rvin a n d D o r o th y L a m o u r in Jo h n F o r d 's[...]D o n o v a n 's R eef. L e ft: p u b lic ity s till f o r H en ry H a th a w a y 's could do anything false, he's incapable. As a Spawn o f the N orth (book caption reads: "I f you had performer, as a man, he's pure" , Sidney Lumet sm e lle d th a t seal, y o u w o u ld n 't lo o k to o h a p p y e ith e r"). claimed, and if it sounds an[...]Sextette (1978), in which she plays the bride of a Fonda. He has always seemed like one's ideal[...]hes as if they were the mann, there is more than a little correspon M ae W est (centre).[...]ose '30s gags in some of his chief relationships a stubborn (" Bet[...]quote a good number of them. For the rest, he[...]is left with an enigma: a star who became the If Henry Fonda made a career out of target of a ferocious purity campaign, a woman persuading us to take him seriousl[...]e would almost certainly have whether in a humid jury room or[...]-- appeared on A nother star who scarcely seemed to scree[...]seriously was not sex or men, and especially not any of the[...]'30s, in films like Jungle Cashin's slim volume (a happy change from the[...]it and probably no a nicely deflating sense of humor that worked one[...]tion in a volume of artless maunderings And yet, if Cas[...]de o f the Road, " as told to Dick life truth is a good deal less amusing and less glittering than[...]" .14 might have suggested. In fact, Mae West is a One doesn't doubt that Dorothy Lamour was somewhat sad story of a creature who purveyed lubricity in public, first on stage and then on a cheerful, pleasant woman but there just aren't screen, and perhaps never knew anything about[...]g With whip up a spurious narrative interest: " Being date of bir[...]is not her have mattered to anyone in over half a major st[...]I knew I could never make it in happened, it was ever consummated, and[...]they all made it, so that suspense is at a West's 1930s films are now camp classics, a premium. This be[...]____________ Continued on p. 580 quickly secured a powerful position at Para mount. Her first scree[...]th e R o a d , Robson Books, 1981. diamonds" , was the immo[...]th with the young Cary Grant, established her as a major star. If none of the remaining six fi[...]with W. C. It was, however, a triumph of subtlety, wit |
| [...]Maude (directed by Hal Ashby) was the basis o f a continuously-popular cult film . Subsequently he[...]st Little Whore house in Texas. While serving as a jury member at the 1982 Montreal Film Festival,[...]fellow jury member David Stratton. Apparently you grew up in Sydney old Chalmers St office; I ha[...]nford, and eventually What sort of films did you make at |
| [...]uch later. In the meantime, I How did you get back into movies? produced several of John F[...]keen for me to direct. However, he offer from a couple of friends, Well, by now H[...]in May and Grand gave me, $7000 to do a director's ran a television film company. become something of a cult film Prix.] Ed was kind enough to take test. They had sold a " Movie of the internationally. I s[...]ipt and he liked it. Ed, who was making a film at a title, The Devil's Daughter. But way to do that was to find pro Colum[...]nd Shelley Winters and Joseph idea for a script, which was Silver[...]Daniel Cotten starred in it. It was just a Streak, in the hope that if, by using It came from seeing a dolly Fapp shot it for me and we did[...]another director, we could make a crane for rental in a film equip three scenes from the film, all[...]Then out of the blue I received a a chance to direct the next one. make an exercise[...]d Silver Streak to Para nically. So I worked out a situation liked it, but not enough. So Maude was a success there, that he mount, but they[...]t and had thought of that became the first scene where ing it myself and Hal Ashby was turning it into a play for the the mother discovers Harold[...]flattered. I went to Then I thought, this is a bit grue came out great; Paramount was Paris, adapted the screenplay into some, why not make a joke of it? high on it, too. Then, fate took a a theatre piece and then worked So it became a fake suicide. And hand. It was the e[...] |
| [...]that to write anything is a kind of They are three very different kinds[...]How did you come to do "9 to 5" ? Yes indeed. Jane is very de[...]about a year. The premise was that before and hardly knew[...]director; I know it was then a pro libs were scripted, I was very[...]ject for Herbert Ross. impressed. Any time an actor fools[...]on it, I went to Cleveland to a Your next project was "The Best[...]office workers. I asked, as a dis cussion point, if any of them had ever thought of killing their boss. It was another tro[...]to get the women in such a stressful tion was put back about nine[...]humorous ways. treats the script with a great deal of Above top:Doralee (Dolly Parton),[...]mlin) and Judy (Jane Fonda) tell Yes. Goldie Hawn is a joy to I have great satisfaction in[...]process I like |
| [...]It is a slight story about a simple[...]The Best Little Whorehouse in Texas. about a sheriff who was 65 years that. I understand why some old and a madam about 45, who I am very proud of[...]it is it better. It is interesting to specu had a relationship about 20 years sequence. We did i[...]late what it might have been like if before, a one-night stand in Austin; it is not a set. And there is[...]Keaton did some of his song. Maybe we have to find a new house. great s[...]Now that " Whorehouse" is a big distanc[...]success, presumably you can pick Considering how expensive it is to fe[...]and choose your next project . . . do a musical, which means you out the day before we shot it, so we have to aim for the widest possible had a whole day in which to I can, as you say, get finance audience, the film is surprisin[...], and I would like to in, for example, the scene where get everyone -- camera operator,[...]excellent actors and actresses you I think it should be naughty, in Do you think there is a problem[...]find the Australian accent delight wouldn't even prin[...]ful! word " whorehouse" . But if you ideas for an ending. In one we had are making a film with " whore Dolly get into her car an[...]Are your future projects house" in the title, you can't be into his, the helicopter lift up with[...]Probably. I have a couple of Many American critics have figured we needed a happy ending.[...]very part as comedy. He I cast Charles. He is a very ences applaud when he sweeps her[...]getting a laugh in the first ten started out as a dancer years ago.[...] |
| [...]nd updated. The Yearbook again takes a detailed look at what has A s in the past, all entrants in Australia's most[...]new categories have been added. A new series o f profiles has been compiled and wil[...]Brian May and actor Mel Gibson. A new feature in the 1983 edition is an extensive[...]nancing, special are ha[...]The Melbourne Herald and always find it to be full of interesting and[...]read |
| [...]on the A ustralian film revival[...]In this major w ork on the A ustralian f i l m industry }s dramatic rebirth, 1[...]leading f i l m writers combine to provide a lively and entertaining critique.[...]$14.95 The First 25 Years A U S T R A L IA N T V The f ir s t 2 5 years records, year b[...]Christopher Day, A U S T R A L IA N T V takes you back to the time when television fo r most Australians was A t first imported series were the order o f the da[...]its own. Programmes like Number 96, The Box, A U S T R A L IA N T V is an entertainment, a delight, and a commemoration o f a lively, |
| JH E yE A R O F I iv in g D a n g e r o u s ly Guy Hamilton (Mel Gibson), an[...]ng |
| [...]true that the film's Lincoln High is a dingily-depressed school, that its central gang is sometimes a variation on Alex and his Clockwork Droogs,[...]ircular-saw slashin are alarmingly gruesome. But a case can be made for Class of 1984. The film p[...]ing as Mr in g punk gang attacks a black student. Mark L. Lester's Fingers suggest[...]film, has been shown on television. In a " Unreal" , " explo[...] |
| [...]iter-director Mark L. Lester . . . Lester is also a film-buff director. Allusions cannot be found to[...]him. The line is has an astute eye and ear for a cliche, and or quotations can delight as well as[...]e actually do anything knows better than Hawks ever did how to quick cross-references to themes and r[...]invert it to expose its absurdity. He also has a (both pro and con) to other films. Watching The f[...]school films. might be tempted for a while to identify with approach to Class of 19[...]The kids assemble for classes in a style Stegman and his anti-establishment stances,[...]nfrontation echoing West Bikies interviewed after a 1979 preview of strong emotional involvement and what keeps Side Story. The psychotic gang is a bizarre Mad Max told television reporters that th[...]the audience accepts the convention[...]ilm, then, could even be accused of gives them a feeling of instant superiority to the violence, m[...]o film. But even in the act of looking down on a mirror and as yet another film showing how are the good guys and how black are their foes. convention, a critical audience acknowledges authority and law are inadequate: a headmaster, In fact, just as Death Wish appeals t[...]is film is definitely on the depending whether you are for or against him) security guards to troubl[...]in gut response before intellectual response. A way of self-protection or justice is in violence.[...]unts relied on the visual majorities. But because a large group in power school is made up of only fi[...]act of speed, risks, danger and deaths to upholds a view, it is a fallacy to assume that all (though they recruit a 14-year-old hit-and-stab The gang prepares to[...]entiments that sound similar are man and a would-be call girl). The principal |
| lompumix III automation and Dolby Stereo-- a new era for the film producer who is looking to a standard of pound mixing and optical track[...] |
| [...]y. Oz. Mad Dog Mora. Gay Cinema. John Sam A rk o ff. Roman Hail. Tariff Board Report. Film U nder A lle n d e. Brennan. Luis Bu |
| [...]seas rates p. 5 Subscriptions DPlease enter a subscription for 6 issues ($18) 12 issues ($32)[...]O renew my subscription with the next issue. If a renewal, please state Record[...]$ G ift If you wish to make a subscription to Cinema Papers a gift, cross the box below and we will $ To order your copies place a cross in the box next to your missing issues, and fill out the form below. If you would like multiple copies of any one issue, indicate the number you |
| [...]ase send me ED copies of the 1983 Yearbook at $25 a copy (Foreign: $35 surface; $45 airmail). 1[...]d me d l copies of the 1981/82 Yearbook at $19.95 a copy (Foreign: $30 surface: $40 airmail).[...]send me EH copies of the 1980 Yearbook at $19.95 a copy (Foreign: $30 surface; $40 airmail). $[...]es of The Documentary Film in Australia at $12.95 a copy (Foreign. YI8 surface; $24 airmail). | $[...]__I copies of The New Australian Cinema at $14.95 a copy (Foreign: $20 surface; $26 airmail).[...]es of Australian TV: The First 25 Years at $14.95 a copy (Foreign: $20 surface; $26 airmail), j $[...]me copies of the Film Expo Seminar Report at $25 a copy (Foreign: $27 surface; $32 airmail).[...]Address.... Postcode. A ll foreign orders should be accompanied by bank drafts in Australian dollars only. |
| [...]new Atlab mixing theatre. fortunate to have had a tradition o f invention and a supply o f creative technicians and audio-engine[...]exciting and a lot easier. You were able to opening o f another stereo sound fi[...]do things that you would get frustrated Sydney, Australia is now be[...]I was at Film Australia for a total of 10 trying to do when recording from 16mm. production o f a quality that will allow it to present its[...]I left shortly after my long service material at a standard equal to any in the world.[...]nd overseas on a study tour, I only got as far setting up the n[...]are also increasing the range o f subtleties that a as Pier St They[...]it was at It was a great experience working with cost a fortune, and ergonometrically was the opening o[...]. He was doing things differ my idea of how a console should be laid able to interview him and[...]x or seven chartered accountancy, before getting a location to New Guinea and all around[...]Easy, The Pirate Movie and a few others. sound department and in the animatio[...]lights to be set up or for people to department where the tracers were. make up their minds[...]for a while as a mixer. At the same time, I I became fairly in[...]applied for a Commonwealth Film Com Lowry into getting me into it; he could see Julian Ellingworth, during a sound mix.[...]" Sure!" It wasn't a lot of money, just The first job I had was as a director's[...]about $50 a day. turers. It was about three young children,[...]of information and a lot of tricks about how with Paul Bushby and lea[...]Did they welcome you? ments and I was the first to go, being fairly[...]Yes. I was not allowed into a couple of expendable.[...]films because the directors were a bit I then worked for Les Kelroy, who had a[...]Hollywood, I was able to see quite a few Nagra, for a while. People would ring him[...]I saw them do The Muppet up and say they needed a sound[...]to come back to work on it again. I became a freelance recordist on the Peter Fenton [mixer at United Sound], I contract which ran for about three year[...] |
| [...]Rocky are completely music desks and, in any just giving us faders and equalizers,[...]t would have been useful to us. I 24, and mix a group of them, say 12. The Portman was mixing Ri[...]was retro-fitted, which can be nasty. If you say thought, let's just redesignate things a[...]them to rewire some of the modules. until you get the balance right. Then add Ordinary People. here, then a whole box of controls has to[...]e way Surely, that is the reason for having a will be the mixer. It will do what it is told So I saw a lot of top people. It was to go.[...]h, with what we To my knowledge, Neve does a very Well, the Americans wouldn't entertain many times as you like. do.[...]t that sort of console unless it was for a n[...]favorable. We the ground and build a huge console. could get a better deal from Quad-Eight in Todd-AO has[...]of the studios, which will remain Hollywood, where most film studios, or all to work in delib[...]ad custom-built Quad- huge buttons and you go to recorder 1, 2 already be equalized.[...]or 3. Our console does look like a music I have done, there has not been a huge thing went wrong, they just tended to[...]board to most people. You can still assign amount of equalization. I don't usually " goddamn" around for a few minutes. We came up with a proposal for Quad- to any of 24 outputs. equalize the dialogue tracks, just the They would then wait until a tribe of thou Eight whereby we bought an off-[...]ign and modified sections of it to Do you have three or four people on the final mi[...]When you have a couple of four-tracks would start again. It seemed to me that looks exactly like a Quad-Eight Coronado, Three or four usu[...]heir hands than but there have been quite a few changes. at two plus our computer. I could very and music, you can put them on group they needed.[...]It started originally as a quadraphonic Stuffs up the union![...]k speaker channels. Yes. Certainly there were a lot of guys I went over to the U.S. in Februa[...]nothing to it: there was just stereo music and a vocal track. They played it to make sure it was[...]of people who became involved seemed to me to be a bit beyond the pale. It would have been better t[...]tead of farting around for four hours. How do you stop that happening in Well tha[...]n the the Atlab sound theatre. We had a few problems building the The only choice was between a custom- |
| [...]Products and Processes sound recordist having a supervisory reversal medium years ag[...]endless loop sup is examined, cleaned at a speed of more[...]f the than 100 m per minute to remove all |
| [...]A TRIUMPHANT C O N N EC TIO N[...]ndustries. From a legend we'll always remember,[...]comes a story you'll never forget. |
| [...]L (L a n g u a g e ) ........... ........ /[...]hi 9 Australia, 767.90 m, A. Folland[...]n, U.S., 89 mins, VCL Der schimmeireiter (16mm): A. Weidenmann, W. A'sian Dist. P/L, O fa d u lt c o n c e p ts )[...]605.85 m, Roadshow Dist. P/L, Lff-m -g), O fse xu a l Upright Action (reconstructed version) (16[...]mson Prods P/L, Australia, (a) Reduced by importer's cuts to qualify for lower[...]97 m, Samson Prods P/L, L(f-m -j), O fe m o tio n a l[...]Video W.A., Vff-m -g) Filmways A'sian Dist. P/L[...]ted Exhibition (R) (a) Previously shown on January 1973 List. E.T. The[...]The Bloody Fists (videotape) (reduced version) (a): Dist. P/L[...]That the film will be exhibited only at So That You Can Live (16mm): Cinema Action, Britain,[...]My Survival As A Deviant (Super 8): G. Lewis, Aus[...]m Corp., Hong Malanggan Lavarima -- A T ribute To Bukbuk (16mm): 1031.18 m, Hoole McCo[...]Partners: A. Russo, U.S., 2496.13 m, United Int'l[...]SKD Pictures, O fs e x u a l a llu sio n s) I Spit On[...]mins, Video Classics, O fse xu a l vio lence ) The Animals Film (16mm): V. Schonf[...]2257.00 m, 1437.00 m, Sharmill Films, O fa n im a I su ffe rin g ) P4W Prison For W[...]cs) Columbia Rim Dist. P/L, Lfl-l-j), 0 (s e x u a l a llu sio n )[...]Embassy, S(i-l-j), V(i-l-j) A Question Of Silence: Sigma Films, Netherlands,[...]artz, U.S., 2203.15 m, Blake Bom To Kill (16mm) (a): RKO, U.S., 1012.00 m,[...]ideotape) (c): C. Argento, Italy, 94 mins, (a): Tudor & Taylor, U.S., 504.62 m, 14th Mandolin P[...]es, O fa d u lt co n c e p ts ) A'sian Dist. P/L, Vfi-m-j), O fs e x u a l c o n c e p ts ) Videomania, Vff-m -g)[...]lt c o n ce p ts) Bitch Prods, U.S., 1645.80 m, A.Z. Assoc. Film Dist. U.S., 570.40 m, Landm[...]etions: 5.5 metres (30 secs) 2468.70 m, Filmways A'sian Dist P/L, Vff-l-g)[...]276.69 m, GUO Film Dist. P/L, Lfi-m -g), O fse xu a l[...]Reason for deletions: O fs e x u a l e x p lo ita tio n o f a m inor) Comfort Rims Ent., O fs e x u a l a llu s io n ) Kong, 2318.00[...]Diamond Rims, U.S., 2276.00 m, A.Z. Assoc. Film Dist. c o n c e p ts )[...](a) Previously shown on January 1982 List. 935.00[...]version) (16mm): T. Benson, Rolls, Rolls I Love You: R. Shaw, Hong Kong,[...]2207.00 m, Filmways A'sian Dist. P/L, Sfi-h-g) 3103.00 m, Apollon Fil[...]2639.00 m, A.Z. Assoc. Film Dist. P/L, Sff-h-g) 1947.53 m, V[...]Pixote (English sub-titled version) (a): S. Naves, Brazil, The Stranger And The Fog: N[...]3490.00 m, Consolidated Exhibitors, O fs e x u a l e x p lo ita 3840.20 m, Cine Action, Vfi-l-j[...]tion o f a m inor) Tadelloeser und wolfe (16mm): E. Fechne[...]S cream For V e n g e a n c e : Manson Int' l, U.S., Germany, 2252.00 m[...]2558.00 m, Video Classics, Vfi-h-g), O fs e x u a l v io lence )[...]mins, Rahima Prods, O fs e x u a l vio lence ) Teenage Dreamers: Shaw Bros, Hong[...](a) See also under " Films Registered Without Elimina 2244.26 m, Joe Siu Int'l Film Co. P/L, Sfi-l-j) (a) Reconstructed version registered " Suitable Only[...]Chopstix (reconstructed pre-censor cut version) (a): W. Bloody Mission: Lui Wai Man, Hong Kong, 244[...]ld the decision of the Film Conan The Barbarian (a) (reconstructed version): Dino[...]Rrebird Film P/L, Vfi-m -j), L(f-l-j), O fs e x u a l in n u e n d o ) The Decline of Western Civilisation: Manson Int'l, U.S., 2743.00 m, Rlmways A'sian Dist. P/L, L(f-m -g), V fi-m -j)[...] |
| Here's why you should choose GevacolorType682 negative film[...]with the will positively enhance the creation of any processing employed by all Australian masterp[...]aboratories. It's a film that passes with flying So if you've got the creative |
| [...]Synopsis: A romantic comedy based on C.[...]J. Dennis' book of verse in which a rough- FEATURES[...].o-n:l..d.eey....i.nheooo..h..t..p.p..rnhaE.u.t...A.r..hr.u....o..orm...r...asa.s....yg.g...n...de.d....cKL...d.g...s.....a..ns..n.....uaet...i......e...i..tre....Ds...aun......o.nyyon.....a..re....a...r....a...t....n...ser......a....sr..r.v...O.p...........iy...w.....e,p.ta.....[...]n.......ry.......n.h.....toB............T.........A..o.a............w.......s.r.....................yw....[...]e.......l..3....eQ..P...............l..s..........a.....G.e...5..VO...n...h..........u......A........t.....r.....mh.--......i..o......h....wi.......c.........n.PMiR....h.a.....u.....P.sw......am...t......e......)..o.r...e...o.r..D.B.ir.Vn..K........nea..l...cs........rat...a..r.........do.aiP...ePr.t...h......i.b.r..s.......P.c..oa...vb...r.d.....g.a.le.a...t.s....S.1A.Nha.ra...i.......neC.oMte...dc.sC....H0.tA..tt.e.[...]re.o.t.....t.s..hd........aeohu.ud..p..grr........A..y.u.......Ms..gs.e..icrc.a.N1........a.......c........t..i.e.ee...1n........gh....c.eo.O[...]t.e..e....g........................r........t..M..a...s.r.i.T..T.....v.....e......n..............i......r......a.......n...R.m......-a............&..............n..o.....g.W.............l...........A....p.........l....L.s.........d...........i..(...........o......d..........A.MD...............Z.....C......r.....e....................a........g...Na..A.b......a..Z.a..................r.........i....x....i......sr...[...].E.g...i.L....Dfn..)D..U...c....ao.....iaw........A..n...a.e.G..gh...D.....on...nM.o..i...S........i.whwrn....a......n.e...ner..y...C........oa..daU...r.M...r...[...]F....M.KM...tk...k.e...c1..BBPan.n..m....ba.r.Bi..A..F.Lw.Iyc0..c.lic.sooaTB...9elS.Dee..re.lL0o.e.rL[...].reB.laa.e.it.yg.uoBSl.t.cc.le..hnt.c.sa...-e.nhs.a.fiw.wsel.tt..u.1.s.nNkeTceoy.ow...oo.as.y.ro.t.r...rh9a.)a..y.lrmvrs...Re.i.srr...glo1.,.rf.as..y..oir.m.4..e..i.i.i...wl....9.dedr...lge..et.al.E...0wa.m....l.i..a....4.p.e...sda.mFit..n.....s....in.(.hE....n.9.sn[...].pr.l.d...i.f.kh......mvl...die.s.e....(...Se.s.l.a...wy...e.....Poe.t...te.n..r......,s.h...dro.....[...].....l.n.Ti...e.ayu.sl.ni..)..n.....u.d)eae.......a.ci,t.h..,r..l.r,.g.t...R.d.r..l.llt...y)..o....iyl.ai.e.ao.h.Cn..p...E.as.HNi.a.t......p..Yw.n..cnhc.m..eh..g..h.n..ha...i..o..eS.nh..k..ca.oa....)b.h..r,..sB.a...w...r,...oeho..i.mtvt....o..e.tes...s..h..o...ecrma.l.e.....bSy.S..re.l....i..aey...ae..rss.C.....uK.A.h..ait.d....adn...ts.ne.ar.(K.....tFieoF..ne..ca.[...]i.lirpion.rr...Aieeulrss..egn.rrrr...rgedle.ao.e..a.uKe.ie..ra.e.d..eutr..c.rlrt.n.....e.udcdpfs..a.cr..n.c.....rrr.t.i..rctp..r..d.....e.n.toFir..iciae.siet.n..t.....s.tu.nog..to...e.o(.....o..r.a..arerr.o.dr.t........tA....ona..r.nni..o...r.....[...]..................L.....m......i..................a.......k.............................i..............................ds...e..........a..................................................a......)e............n........A........R........,................................[...]................S...........e..........s..........a..a....h...e.n.........................t...i...l.....[...].........n....i..........l...lh.....LJ..p.........a........d...........................(.aALr....e...[...].aG.....b.............ne.u.........H9...c.........A.......e...o.........e.M.e.ndW.cCM...K..NM.7......[...]l.l......J.rRh..Aon.PeaPPo.C.F..e.PonaapP.ua.Bham.a.JSKiCriatb.ol.mihhhnlfWoerkreghRiBrrKRaoaymelrers[...]yt.an....as...eni..oss....bn..s..crps.b.nd...tp...a..h.es...re--.t...etn.y.e...ie....eom.a.it..o.e.pa....o.o.h.d...te.....rf.tn....uscna....[...]J.....f.e....tt...tt..n.ol.or.o.t.re.yoy....hhe.e.a.r.,..ay.....aeu.....ur.r..n.e.ne.n.A..i.M.c....sa.nJxm.tlr....bRSa..gdit.hcyl....uc./n[...]..............................BruceEmeSryynopsis: A gentle comedy about the end of Prod, company.....[...]rts Draughtsman/model m aker......Gert Schidor G a ffe r............................................[...].t.cbygipg..os..t.pe..e.r.s.o.:.....ry.r...t..r.o.a...o............F.t.p..c......o......o....ks......[...]oha..t..hvgtew.n.hc..ee..yeri..wrna...rbs...meg.z.a.ee....ys.s.oxg......eo.i.c.wgn..w.dd.o..o.ne..r..[...]...........................D.......i..M...........a............a....v...........l...i...c..d...........o..........A..D.l....P.m...M.d...a....e....e...r.a...n.R.rP.r....re...m.n.y.i...a.c.l...y.l.u.aDMhKB..LW.l.naBeaRDoaanrvvaarrsdooei[...]ay.c.ro..)r..t.hs...nm,.y....ot......o.....e.Rl...a......c...n.o.....s...k...t..b...........Ga.y.....[...].......P...............3S.M.....(.....5K.L..).....a..,m.i..o..l....t.aW....td.m....h)..J.JaG,..e.e.i.o.k.m.a.nrw.P..he..n.7d...neg..Ca.2Py...t...m4eF.au..DH...7r.ram..o..os.u/.i.A7rW.tohmg.Shp2tneh1lfhhai9ausnre1iimt3b,ctlg0sy-Bm[...]g..n...e..r.......................................A....n.....n.....e......B......r..o....o....k...sSD[...]...............................M......u.....r..rJ.a.e.yPnRanuyolbQHeurotilsgfoolerndy two kids in to[...]n (Agnes), Geraldine Turner Seeking sanctuary in a caravan park, Jenny Prod, co[...]..................................J....u.....l.i..a......O.A..v.l.ie.sJrotoonhnBnaRroreoACCtktsalasmpt epgrera[...]poignant story of a small boy caught up[...]Sound a sst.........................................Graha[...]Film Prod. Synopsis: A contemporary comedy. The Prod, manager...........[...]......................... Phillip Adams |
| [...]cd.un..r.setetcote.LBarrbmn.rn...r..ay............a.tcdLnL..ta.n...h,iBac.par.t.d....t.dh.p.sut.....c[...]..sobp.,.aanet.o...i..Pn....sy.r.r.......r..ng....a...o..y.h..a.prha.e,ros.......t.Sc..........r..u.d.d.......i...e.r-r....o..n.nn.r....t.t...sT.........o.a....a.....c..vM.l....r..(l..s...yr'ny..ty.et.s.......a.r.......v....a.....m.....iP....e...zb.....t.TsH.aa......t....o..[...]...y(...ssh...p.........n..)...........r...s..e...a.y.....a.s.....a.....Mu...........F......R................,...p...[...]............r.....n...ta.s....d......n......ri..c.a..r....r.s..u.............ani.......h.u..y......bU.....a..n......f....a....y...s....h........O.s..r...................sw...n...d..h.......,....r....A..............c...v.....o....s.....w....o...y.n...[...]....i.........g.....t...................Sc.....t..a...sW.....c....i...i.o......,.....T......f..........iL........(ku....h..t..s.a.n..............h.....a............a.l....e......D...e.......Tn.m.t...e.tC............[...].e.....t...n.e....o)...th..............i..l...r...a.......i.....r..a....y..s..W..h....a..s...s.oti.....(........,...n.e...............w........t.l.e....CEhKfd....a.....e.............e....RM.....n.....f.........U..[...]dOnCP..so...l.........t.i.B...................ri..a........r......sr...s.........b.o........c.tmraw..9.......n.....bD......oT.oC.......(dn...g...a.........a....c.........p.P..ta....G....r.hoa........bGVJMo.[...]..3...........r..t.e.....iv..p....l.S.oe..)...h...a.o..n......u....B.Py....o.....nit........P..ntc...[...]..........0.c.....m...e...rhL...fi.....GaT..u.E...a.n.no..i.v.....i....c...lmr........H..n..n.......o[...].la....g.s...r.htthst...enn.d..I...r..tc....eee...a..y.i...Sh......i.M..PFDu.o...ou..tee..oo.....tAe.[...]r..m.e...rI.....(f.bler...okm.).1.elnn...hx.......a.us.o.........tt..l...ai.eMo...Sln..n.Q..hy.......[...].W.."d...eeBlt...aengG0i...NiL.k..e.r.....r.......a.lL.b.C.....Cmh..ked.tM..g.....u.ye.....t.e.7...l.Bw..mne.....eLee..F.ma0aroh.h.uc..a.eei.n..P....l...We.m..1.n.uo.....HMrAC..Ccel...di[...]p.isrrab.ogsdrcdetyy.iarstem'osououn..b.pip,aai./.a:emsi.snrtoreosiddo...aetccte.lrtdw.eletosm.vdptos[...]dro.eeltt.yisess..detpdcalap.en..rs.olir.poa.sipe.a.ipiiiu.cnuu..MesrMaig.r...irg..sesaei.ssra.sy.sdirrap....trogrturp....r.a.su.e.delee.rpa.W.l.dotMmhi....caa..r.n.u.a.a.sosero.eta.tt..t..--er.e..s,e....ad...r..r..ct.rnnsan.c..ara..et.a.s...e(.t.i.s..g..y..ups.n..s,s..ttrpn.r....,.d.ca[...]....,.an.is.....o.rh..i..o.r..t.....O.tc..oo...rs.a.rsn.e........c........rt...........eiM.n......e..aa............t.R..hi..t...a........r..any.r.yk....t.n..t.......ir.......n.t......r..........'......r........s.na.....o.....r.e..........s..a.n..n......i...N.............n.i.....,..n................e....I......n.........a............n..n...........n.....s..&......b...n..........e..r...S..S.....t..............te...........A......a.............eC....................we...i..t.............e..)..........d...................t............n.a.....:...k.............y................O........,[...].e..............................f.....n.N.c.......a.........e............n...................o.......[...]........E........e......q........u.......C........a..a._..r..RAiV...........a....G......e..CD....J...............s..........a......i..p........Lt.......M..........r...u.......[...]c..........u....t....e..s...............,d........a...e.0aa...aa....l...nrtFbi......VW.ea.......--...W.i..a..vD...S..i..cE.k.i.....iri..n....a..o.e...s........yd.i.l.....n....l.,m.zl..it.M...R[...]mm.gaM.y....ihc....Mng.b....n...ld.n.i..rn....SJa.a..ri..CDEa.e..Ri.K.vx.iata.e.G.....tu.n...r.rd.M.T[...]ti.eneYa....m..m.....ieliiea.i.lCiioo.BJC.ar...lT.a..aCrreriHr...o.aisHt.ci..creiCa..etJeas.deom.nec.oos.....eJ.naerrRali...ak.dr.y.s.nveD.grBWe.iee..nu..A....SkrakIne.mh...a.oe.or.wmhlwnaee.eNea.ntbem.cloo.rn..e..i.ve.eoti..yag...VrGI.a.naiahdn.ts.D..e.MiaIar9rl.lP.m..Has.au.aWGdndn.We[...]aer..l....Ga.ocoJi.ttadCMntuh.iinBy.o..MMnmaeoYa..a.ei.TDC.aouNBoveodhuuelciBonmu.Ce.Hi.aOPaKnA(d..no[...]e.cMg/tadiro.io..eiy-(ppn.t.ad...ricssr.rensomiuw.a.ss.dtl/tplo.enEK.d..eari...ss.nr..Peyio.tmcifdwn.[...]..ds.la.yereseatoTl..s.ae.r.oeopa...uhor.g..h.rer.a.....e...iaoesei.ao..uheetr.onr.....gdp.aTr......r.a.e...e..ra...sd.reh.t.t.t.io.oh.irr..rru....eraa...c.rd..a.yrkcH......ie....tr..s..srty.ta.rReap.en...cn.cr.[...]sd.gc.ts...yocs.ouf...ne....K.d.kp(....tn....g..t.a.dte.........n..t.i...r....t..nn..Rt...s.dt..Wc..r[...]..o...i.g.e.L..t.tsa.i.in.re..o....y....rca.or....a..o...o....seg..e..t.....y..nir......soy.oo.......[...]t.......ert.............Ns.......u.e.........e....a..r....ov,.......................ea.........o.....[...]y...........l...........il...............l.....s..a..................................a.....)..cKe..............TtW.......H........................................Za.......a....................I...m.........................[...]..p.....................f.....ii............R.....a......................r...u...............h......d.....l...d....g...(.......a.........................G..L....................h..n(k......C.............a...............M..n.............................t.[...].......................e..s...e...................a.E...................)..............r.............[...]..i....,........C...oy..............n..........n..A..............d......................s............[...]...........o.....cn.............,............r....a.W...SSJJA.l.............................................NL..........Ri...Bt......)..t.o............ei..A..........r...E.....te............tJ...e..........[...]p..s.........B.e.).r...............u..o......e....a.......AG..AMJWLt.......cr...H)..g........NN......[...]........aaor.........an.KB....uP.p.l..ui.....s.i..a.m..T...........RDGPRie...i.........ha......C..lse[...].....Br.n..wo..l.B.r...Mlry.....n.o......hsK.ue.y.a...........D.r.r...l...r....nr..tao..ri.HroF..w...[...]...,ehc.nn..mr...bMn.S...n.ibeb.v....i.....n.l...,a(.....C.n.e.Wg....raE.t...SB..ln.....eaaA..rl.WIL.[...]Arr.eBAa........dyh..r..t..eQ..y.CCa.er.T.iBM...B.a..n..BPt.oaao.SH..er...rW.a..d..A.ap...bn5puO.sK..r...o..r...naJ.r.eM..hu...oe.G..r[...]rtcK..lua.aiRC..aa.erab...s.AB.tdaCes..GginB.iAp..a.vnn.nelbsitJTDt5oAimi..RS..t.an.lmnrrPsfo.Lo.Fnsr[...]apgs,,,,ecd,pirrulpr,tsoptcimarinnsrnssrdidegaait.a,nedaestibtrsr(nreadiwn-pcsanorntmia.pgisanrbnhrco[...]ui.irn.eosrr.trJr..doL..uoeeu.......oe.nhrnd.eer..a.ta(.roetdr.ens...nerre,.ueet.c..v..y..cdrtgn...nia.syeris.B.._a..daf.sun..coc....a..dmpena.e.cr.c.r.sTtni.rc.c...dt.ecr...c(rp..t...[...].sr....)....e..s.onrv.ouH.......r.tn.....r.pas..i.a..r...rot.....ND....t,...nt..i..t.ogrr.ty.......Jas.....rv...J.v..e....E.ge.r....n..a....r.........tt....lno......t........t....d...E.......ev.....a.eh.y..ih..o.i...........o..Ih........r...i.J...t....rdc........s.)......t.........r.vn...........e.....a...wv.........ny.te..t....sh.,..............o.r.............e...h..f....M......ow....bi..m.........a..................a.......il........e......n.....ofn..V....y......n..........d.a.a........C........J.....oMi...........ur...............r.......r...a............r..l........l......a.t.....W..nG..i...a..b.........a.r.....D....u....n...l..i...o...tl........f.........t...............o...r..........c..a..d...L..........r...o..r..e...W.......K...i.yi...l..r.....t................d...d...........ld..t...a.i.l..y.........k.........thi........ew.......s...[...]ii.........R..r...h........l.I.....o..J...........a...i.....r.t.....v......eNl....................D..........aN....ti..s...eC.......n..iyR.a...M...t..........e.......B....n.....l(.e...hMa.nr[...]..R...l..............d..T..n....e.sA......BA..ii..a...Ge.....T....i..........h...n.....n.A.y.ol.tK......a..s..I..r.r.....aa.............r.KWeo...........l.[...]....n.h..u......odes...iir.....ln..r...iW.n.e..bG.a....u.........aRe.....u...dn..l...me...eg.Be..J......F.Q.i..H.....i....e..e...c.....y.Hn.a.c........asBs.......s.sd.C.A.....i.Z.eb.....frFCa.....a.n.(FD....sCL..acne..K...eRPdfr.o....R.i.....a.ofnrMee.....C...ice..i.m(Uhmu.JK..s.B.MTPBun.e..R.rraEa...r.ese.....eGl.rretc.reGNehrnnyS..MJD.rmB(RRa.bF..a.a...e.ekeolear.o...Ino.s.araotPgy.aade(.ihm.Lr.e..h[...]n.rGosCGBCaary)s.inrami.e.vli..emAnecto(.pttn.lar.a.wrscnrocPacdhWtynaHanVell,a.iCreaaR.d.v&.abi.ntue.tNrtndMeaaohimsca(hsDyailiW[...]lWeahBs..lnrnraaEmiyelcrsSniso(ilHtMdo.BYr.l.dl-N.a.stQbiogieioyrclaHnbdarn)e.ega,C.C(BLW.loeHe..rDei[...]r........c.rt.Hce.vts..........,...c.Sgdioi).r..e.a.i..e......i.tet.ope.eba.aDc.sw.d....k...ai.stt.nn.n.o..cc.c.t.r.y,...t......te.oo........n.....a..to..nA..m..ai..i.........aEroy.pi.rsh.rtr..r....[...]ns.yn...akk..e...eo......n..S.fi....n..o.r.J..o...a.......n...r.)y..........m..ea.r.irs.h.......y..........t.....irg.r.....n....yt....l..sr..e.o..a......M...m..t..rA....en..wr..t.....m...O.t............o.e.s......i......n..y....e.........o..........a..D....)....g..r.........n.........a...n...........................s.l.r.....o.....c..[...]...i......................n.............tB....t...a....i....A...L.n...t.o...........W.........a.....n............o.....a......t.....r....D.........r......................[...].......o..l.........c...............n...k..S.R..t.a................R..............A............a..........M..a.........e.o......o.........D.....l..........M.n.a..e........d.......e.........o...:................[...]r.s..)ein...l................aE......g.........sa.a....y..........e.d.....i.......y....s......,................E....u....o.......)....n.J........A.............le...&...............e........e......[...]..,..ab.e.....t.t......9....................e.....a.lV.....f.E..g.D...l.............r.yRCi..M.......y.............i.n.a.(.....r.e....i..i.......c...S...G.a.F.O..M6......a......a...........z...M.....CWR..dml.....s....i.......pl...G......Nl.J....a..A.s.K.n.....Ri.c..o.....M....G..Oi.Dl..a.........RCCi.i.a..lRa..n.g..w(K..AsR.......z..P..r.o....crls.o..i...e(eK.ai.e...NF.v......h.eC.Li..nB.FmD.....ee..ail.nc..ar..a..doJ.i...bL..R.cFnt..haa...Rc.u....eP.i..aGihaszE..la.o(.oio.h.rOniJ....r.r.a.A.a...oei.i...cc..T.rnlsh.drc.na...deorDub.a...aPEeh.lEo.iRPni.kgo.v.etbi.e.R.R.mPiVratmr.aP.o[...]Synopsis: Two men and a girl set up house[...]the outskirts of a small country town in the Jonathon[...]Producer's a ssistant__ Margo McDonald[...]G a ffe r............................................[...]ompany ........................IMC-ISRAM W a rd rob e .................................[...] |
| [...](Filmco) Mixed a t ...............................................[...]ucer's assistant ....... Vanessa Brown Synopsis: A love story in a combat zone. Assoc, p ro d u c e r...............[...].r..rir.c-.s.g.r.:nyui..oP.s.pkem.t..i..n..roer..(a.as....ld.T..saAc...rut..Ff.(..ie.r.r.sk.Ln.nl..e..oo...niT.e..i.ad...z..vrm.(..t...n.srt..Pe)os....A..o.e.,.ja.t...r..oa.et..wrl...).cnh..e...y.rm.,r.....t..eh..eg.xK..i.......o.eN.si.a...N(r.ael.....pn.Belo.o....ne.ar..i..Ao.-r.c.rr..[...].lorn..G.r..sde..i...)L..fl.dM..Jy.l.e,...e..aa.(.a.sa..wP.n..(ar..Jnt..t.yiG.L.he.eo.Erce.di....ol.o[...]..ro.skJ.se..Mt.rai.)er..eie.usaty.o..ti,.(mc.r.s.a.ea)nsc.J..n.F,...c..dnko.a...w.aa..r(Syna.3MHn..iNTtr.omAneP5Nta.clohFua.mai[...]a...rgoio.i.tn.e.obks..ol.io.eura..g.n.e...ucyt...a.tp.c..n....e..l..irt....p.s...gk..ss...P.r............h(...A......(.....u..J...C.m....C..y..........nJ..n..u.............u.....a.o..hd.....c...n............m......nur..he........[...].....oa..B...i..nS.........n............nn..c..r..a........ts.......u....).eG......'.....,..C..s....c[...].m....n...n..G.g.e..Se...P..aE.....r...s.oot..t...a.p.na...eeae....)...t.r.....ree.,d..htc.s.rS...y.e....Be.n.tet..(..ui$rm...C.CvRciWr..S.IS.z1l.)...aeleM.a.oLh.o,.yc.tG...nam.i.inlrtSh(rWKnuoM.GhCiroDKl.cs[...]G a ffe r............................................[...]Synopsis: A psychological thriller, its plot is[...]ures of Dot and the a mystery of manipulation and double[...]...h..r....E.....i.J....b.......v...u....rP.......a..o....l...i....r.n..a..o...o....sRVM..nkJSdY.Y.aioeu(r.aoo(y.EaFghrc.ln[...]ein.am.,tt..r.ep.hda.c.p...sS.tp..ar.eobe.h...eh..a.t.vn.ro-.e..iny....dno.fwy....u.ls......ityi..n..[...]...oh.....rFr.........e..Tu..K.e.u...r.......t.n..a.ulsYe...a....e......g.nrb.s...r...g..b.....ykt...a....r...am.a.......e....n...r.D...n..al..JAl.dD.e...taon....l,[...]otsagtoybyosttl.roii.gyc....g....in......sr.......a...e..t............p.r...............h............[...]...........................C......................a....................r...........E.l......i..M..e......lR........i........z..a.....o.M.D..A..aA..t.CUPc..t.ben..ahCtka.h.nelad.reayEPuD.hritP[...]Synopsis: A remarkable relationship be Shooting s to c k ....[...]tween a young teacner and a deeply- Scheduled release ..................... J[...]off as a delinquent by most adults until (Gregg, Trixie, t[...]to Verra Plevnik (Jane), Moira Maclaine-Cross A d m in istra tio n ...................... Meg Row[...]ks well beguiled The heavy gate of night. A n im a to rs .............................Paul McAdam, L[...].....................AlexMcPfhuellye unaware that a killer stalks the streets.[...]ocus puller .........................Brendan Ward A mother and her two sons survive in a dis[...].......................John Stuart, Prod, c o m p a n y ......... Petersham Pictures[...]Steve Lambeth Prod, c o m p a n y ............... Rychemond Film Sound recordis[...]........................JennyBrown |
| A brand new ammie[...]newly completed commercial sound stage. A double feature you should definitely make a point of seeing.[...]2113. A u stra lia Tel: 888 27[...] |
| Props a ssista n t.............................. Igor Nay[...]r .......................... Robert Grant Scenic a rtis t.......................... Ned McCann Sound[...]licity ......... Brooks White Organization Dog h a n d le r........................... Dennis Hunt 1[...].......................................... 35mm G a ffe r............................... Chick McDona[...]S..er.l..iaEroprgioi...u.audr.me..h.rueeetYe.sdre.a.r.......rohrnpd.ra.e....nl..t.v..eecasn.sC.orctr.[...]..n.l.o.n..ony...e.d.on.t..r......tr..tN.t....f...A....a...ue..re.o....o.ts.....e..mJ......r.rr...........[...].....o......g..o..,..........e..........Q.........a....a.......a..................h.a...o.l..r.............s.,......s........n..sh............a.m...........lu....n.L..m.F..o.T...........l.............o.d..e.........................p.l.e.i..a..o..a.............s..i........n..Hc..r....m........k...[...].e........i....M.l..iaf..DTH.......y......s.....s.a.s....e.,........y....A...A.a...c.PADAMo......i.)..is.t....i.t.y.oa.e....k..m.t[...]..nEl.WFlrF.chlpCci.yn.aD..iMW.mr.tlninFtoaArB.d..a.o.l.-dilretB..Mh..tef.D.aeroGe.oKeFuer.i..ettP.ca[...]aafr.ragt...o.....gdoap.o.hi,e..wo.nnke..i.te..oi.A.tr.Ir.m..rth.....srfolr..sairr.bw..i....D.o.dri..epcce..tdf.R.ra.alm..i.t.....on.......olcne.ee....a......rt.es..t..ir.rri........pu..Ny.oo....gnst.re[...]......t..eu..s..e....e..y..T.....t........ho......a......(.............o....n........r.........E...m.[...].......o...l..................n..........h.i......a.......i.........r..Sy..a...m..o.w.......l..............n.........d.ee..........r.............)..A...r................t......dP.......o.y...,...ae.r[...]5O............s...n...........m.........n.r.......A,....s.........2......h...........L...et......(p...............,..R.i...o....G(N.S.4....a(O...es..........R.e...d.....t...G...........J..P....i...7.i..e.an...tC..a.........s..orn.c.......f..Na.e........i...E.M...e..e..on..fs,.a........n..a.le...S.a..EG.in......Cr..Ba..TUE..Cic.gc.d..r....S..FdtF.Pcl...ot.a..tP......ad.va.rlne.t.ehe..oh.PIr....a..nWoky.oo.r.Zwiae.o..n...E.a&iloen.Gsr)DDv.a.BBer.r..r.olD.sie.onxu...,ya...vetln.idRao.ndtake[...]i....uao.hh.eoe...ssr..d..narr....ciar.ru..rrr.t..a..drr.....e.rn.e..snMn..seya.r.........oa.yr.td.t..a..u.r....le.........e.ioi......i..yce.t...ctrd............ro....gic..p..p..a......c.....a.y..O...s.ro.c.r......t.............t.rr......n...[...]..................................................a...............................................G..[...].............................l....................A..................................................[...]...............O..................................a..............N....DCJ....a.......MO..................................M..............t.........UJu..............C...n.........at.....a.h............p......i........i.....a........l...c.......W.....in....d.....t..n..a.i.T.....hc........t.........F...a..a....n...h............i...F....s...a...n..v..B....hc.......r.............l....enr..e..a..............o....ii.....yre.....a...aa........G..e..es............r..a...e...........R..n....l.....SPGl...n....enM...tS.[...]....r..l.B..o..e.-D...M.....o...H.....el.e..k.eu..a..I.B&o.....eaaak......l.....a.p.a..Je....PC.l....w..ei....r.tzr..n..i..auaP.i..e....rra.ol..E...e.Urnl.a..hne.c....l.....n..y..e..rra.G..taat.b.m..nr.....[...]nnadiaooc.ugraeyloicrdge)o)s..i.oittoe.ti,iblrag.,a.roitp.s,mooidir.lSsypetc(.....t.trseisent.dtea...[...]..s.ia....h,rr.d.s......noseoermty(d....o.n..ri...a..Tei.e.e...a.t..Ka.s..y.....ntB.yh.cd....o.lcr..c.....yt..e.N.[...].br.....rX.g)..r(......t.....e............ea..,...a.i...S_h..t......g-.........r..nf.e.e.i...........[...].yp..h........p......(d..r..............r......t..a..d..t...r._A.S...(.....f.........e.h.o.ei........r...........M[...].....o.ii..h...i.s.h..(.c.h.....F...ds.........n..a.r.M...............S...L.....a...t,...i....r.)...eac....i.s......e..Ml.te...s....t..........i,.....e.ln.Md.S...t...ihe.....s..acWa......T)C.a.K.tt..a..................o..sM.reR..,c..l......t,.t.Bi.d.[...]vP.nMS..t..p.RTl..kgi.i...in...rn.J.nmT..hcdii.be.a.aa.Jr.v.E....aeeoo..h).CJ.i.i.H.oCdk.ohi..eo.F.am[...]y..ooh--Ear.hn.no.irahhk..PLe..lyya.al.hn.siroc.t.a.e.mlnn.nn.ayC.ruopar.x.aOCa..ai.h.t.)LGc.toE.mt.i[...].ebpxsSSh.shbM.it.traa..'Wd.lu.d.hieSle5.o.lyiSH.)a.taopca.palu.Ca.na.uLSlec,.mLaleH.D.rRs.uFBtyLH.am[...]r.e.dea.e..r.o.s..i..rWa.e....u..ry..yesn.i.n.....a...ed.ai..sr.rr..rena..i.........n.c.rf).o..t..sdcs...dt...y...g.t...a.ip.r..on..dKnn..........e...s.kas..u..t.....a...e.i.........m.h...to..an.A...at.R.....e.e.rt..t..Ln...t........o.........ra.[...].i....s................n...c.........e.c...n.ah...a.O..........a....a....o....e........e..f...N....d.....t.l.....sr...p.......o..a.J....m..v.den................n..R.R...a.....o...r......p..PuR..i..Fr..re..d.....R..R.....[...]..E.iaTB..t.oA...e...i.C.ne.)...lgo.DDi.r.Snit..t(a....m.n....c.,uc..G.sAeihr...r.C.V.t.s..riu..Jde.a[...]aA.P.dveos.r.&s.n.Sh.neFC..idE.en.eirMa.r.lMiR.ne.a.sh.elrh.diealea..sd.ndnM..),ui.b.ein..lh.t..nceMa[...]s ............. Stephen Amezdroz, A Filmco Presentation Lab. lia ison ...............[...].ra.ue...o.e.o..er.d..o.....nd..c..r.r.pr.....it..a.s.tt..en...o....aeo.....t.........r.ag.o.....n.r..r.............a...trr....t..........o...a.........t..............o.r...p...................[...]....pa....K...TT..G.Pn.W...J..C.r......ool.c.y.h..a.aa.H.....o...ebbu.....isr.u..l...e.n..yMnyy.sl.i....s.i.u...a..s.pd.......c...k.SHru.P.PS.y......n.D.oW...l.C.c[...]snlzwnzceesyssrnluehedeeykrrllFHMMMPMoelccaoulaeC2A3P1PCCDCECGUPKFArrnslyrnrsserrxoaekrloasnoidlheoot[...]......as.t.......t..r..r.r.......t...n............a.................t..............n.....s...........[...]S..........D..........................M...p.......a...M.............S.y..CM...n...eCS......A.ir....nt...rrao...ah...uo.ivn.....y..ar...s...gi.[...]s Condello), Peter Sardi (Lino Condello), Scenic a rtis ts .........................................[...]Synopsis: Two turbulent adolescent weeks Neg. m a tch in g .................. Margaret Cardin Prod,[...]Jenny Day in the life of a teenage migrant Italian boy Still photography...[...]nn Walton background, and start a new kind of life, Boom operat[...]osthetic M a k e -u p ........................................[...]..........S.K.H............ue....aCD....zn....r...a.hvi...eG..v.erH...ii...ysad.C..a...Mi...zll...MeH.e.Ha..MmJ.lwauawJearrresodornvyo[...]tyarsaubertpswtryseiusrses.aoic.trs.rts.p.tid...o/a..s.d.r..n.n..o.r.....e.t...b..s....s.....e.....s.[...]....o...............u...J.....R..S..i.o..s.....e..a..c.e.....n..n.k.D...Ke..Nd.B..iA..Megy..e.&.mnAbd[...]Andrew Plain Synopsis: A period comedy drama set in[...]................ Peter Maxwell Construction m a nager.......... Ray Pattison Supervis[...].........................Bob Cogger Prod, co m p a n y ....... Ryntare Productions[...] |
| [...]Paul Marron, Ward, a s sistan t.................Melanie Velinos[...]..................................................A...n..n..i.e. MPuargraeyFranLcaibsoratory .......[...]i.phe..ainrsn.h..pa...)oiAacserrpWr..oih.yn.h.e.r.a..sut.s.ad..edr..r..ea.y.srTrr..nt.h..e,.(orrpus.d...iri..deay......d..ne.i.iiagP..nred....ipaada.a.ra.olty.a..esS....tnssnv..w..a.l..tl..cnlr..u...e.ih...d.r.n..w..ii..o,d.Ten....[...]..Ogi...Lntpo.....m.....ee.n.......ir.dc.t..aL....a.r.s..rbr.yhri..on.t......rbryo..t.....s.nd.t.a.t.f.c.se.ta.v...m............e...i)...p...o.n..o..Aio..ai.C....na.o...e..s..nNo...t..a....ta..r..t...ny.r.em..,.e.ih.gy......eh....r.t..........ne.....a.......a....fr....r..r.t....d.s.t......o....s.t.n..r......[...]..o..u.......G.....r.....c....aC....dg.T.r...Bpl..a......t........N..e..d.................r..r.o.......a....o...o.....o....v.......T.r............p...aBre..................e.a.,r....a......d..s.r......o................uh.............[...].r.......rk........S........r..n..t...r...........a...H...ru.p...d...........k.i...w...l......e(.......y.......rr..R..i.......).en........a.se...d..........e....i................adw.....J..[...]e.........n..c.....,e...rt................B..v....a............s......i.....nn......E....ht..w.r.....[...]....nc.....s................d.....oo.O.........e..a..w..........t......o.f,.........e........cd......[...]...n'.s.....sME...o..........tf.....De..R....r....a......K..dn.......n..e..a...T....e...............t.....h..i...:..g..........hC...t.........A.s....G.iPR...........e.h.......e.....r.l.......M.a.....a....s...e.he..a.o..eh..V.....a....a.......UiB.............b.r...GA.S..f.....C.G...e..w....M...z.......(H...n........nr....h.a...a.R.o.aA...nd..a.eavr...ne...n..........t.y..............B.l....oi...r.....asJ....RC....o..a.O.r.t.nK..a.N.........crdiF.A.CMrrih.r.C.b.bJ...nsMsetM.lcit.r........aPM..h.ME[...].(..d....FSc.tS..eseria..i.it.o..Fbnt.o.t...l...i.A...,eB.hPrt..hATa..clAoRi..ye.l.ielnraph.et..ht..e[...]..Egrr.n..siarfr.de.oadyf.nn.otlicy.lerdr.pnwyiso.a.e.pccs-..ndE.so.tn.iici.oa''..fnfnii.jjest:cn.thd[...]..s.s.ruidmrn.w.hrr..l.i.d.tar.eieiusaao.ssi..ss..a...s..gosseie.T.she.i..u.ehgnrr.rsgusdecceet.seur.r.Rt..slo.......es.trsm.tr.r.a.nmc..s.sscst.ce.rrid..f.td.......m.heah...ad.sus.[...]hh.p....prr.it.f.tte.i.ii.....mE.r.......oe.tiai..a...ieaso.n,...m...p.ntcs..aoo.ts.o.d.aep.(....c.c.ttst......nt.t.o.g.)...aa.r.irr...e.....ic......o......o.s.a..oo.....ecN.s......er.I.....tos,...rno.g.....o.srT.h(k.t.nn..l..........tn.kirea...p...a....n.i......o.N.rn......le.....s..a........o.Ls..a.tynorn.....r.rBr.t....tr..r....o...mn...r.e......[...]e.............................t....s..s.........p.a..R........a.....mn.....r....s...g..i............o...p..............s....oe..a..........bs.......n..I..n........................[...]...........i..........l..r.....Ne.....s....m...s..a.r......E..a.............r...R........a.......................t...r......a.............................nl........w.e...yr..)..................h......e................a.n.v.....r.........tl................Cl.....t.....[...]...er.........................i.g..........._..e..a.......r.............e.....s.......(i..........z.o[...].........B.........._.........d.I.............s...a..t......................R.r....m.g.d.............[...].........'....H......._.k...................e.....a...b..............F...s.....................es....[...].........o..r...................r.....r.K...R.....a..r...J...S..d.........o....d...B...re........B..i[...]....t....o...aa........i.d......rC....oS..s...t...a..h....t.h.DBeEd.a....h..i...t.e.k..l.P...V....Re..D.o.KKPrn......i.[...].n.l..aa......s..n..di..M..u..sa.Si..CW..h.yRr....A..r..A..r.aa...Aa.lnP.....i.nh.v.w....aenen...R..bdoah.p[...].r.uDhRCr.lG.rg.ir..e.e.o..nPlPaeto..conee.n.er.e.a.teBJJeldVSL..Hn.te...TCrynla.Mnmant.uhegou.il.d.d[...]pad....u.uon...raryara.Rertr.i.ga.rt..wo/.ii.r.r..a....t....o..r.nrs.t.rmar.a..l..si.gveaniri...n..dn.....d.u..n....ainifc.cSn.[...]e......c.rE.t.....ga..iceanok..i.o.t...octgst..r..a..Veei....ro..ny.........sb..'...aa.aa.i...a.P.f.r...o..oatmr.....ys..ht....r.....iH...sSe..mt[...]....o..........y........os......co.nrr.eYz..etd...a.......k.......La.a.rcV.r.u....eVe......l.f..p.t......t.....a....r....e(..Y.......h...y...e...g.e..r.bg.......r...a....d.b...r..rcJl.o...t......gM.tn........r...........r.....o...i.......npE...H...e...t.d..............,i.o..a......v...o..a......p....ot.y..udo..........l.....h.......o.t...[...]..........y...ao...eh...........r.g............e..a...s.rA......raC;......y....B)N...hs......b.r............e..i(..a.)..........n.d.............a..s.G.,.n..o......y..s.........i.ih...C....m......[...].........._v.mT...e....t.........S..l.....e....l..A.............._......a.........ak.....a...ii.....(..b...c...........F...r....i..e.d.b..i_[...]....................aG...liPW.......Sn..E....ea.e.a.C....s..au...S.....i..i.l......srMt..d..i_.....k.[...].e.....fiF....e.e..ap....n....noa..p..nl....ai.J..a.Eaa..dh....h....r.rh....o...G.h.i.Taii..G...ae..ue.SCsr....irr....a....n....a.Prrc.asJSclor.v..ag.M..es.r..B.hctb...innu..n..eA[...]RruwSaw.h.)hae.u.i5ahbwn.trmdteLpa-hhH.meaafmioMg.a.do..iSSa,u.tcaaChLCl.uwAleaSOg..elslSMD..dHduDtar[...]ht.nc...oloa.oiyainod..er..oe..l.rar.sipoaaS..iIo.A..F.bT.eure.rame.dds.fr.....s..ur.trwrad.dr..n.en..r..hye.a.hnna...tc.r.sv....dk.tu..da.nee..c..s.era.y....a.a.ucretc...t..nS....i..ei.).lia.cr...h.ryo.r.se..d.[...]..................n....o......r...r........n......a...,....a.a.....c................t.e......a.n.pZ....................et.rD.......rr...oM....C.......O.......a....n...an....J..o...m..,.......b......o..........[...]....sso..............i...F.u..ian.................a..ng.a.u...v...)......h.e..tL.......v.....i.....s.ne....[...].........n.di......ny....i....i....rd..m.eL..t..G.a...t.........b....R.iaeK.i...on.u...L.....R.Be.e.A..e.M....JJl.......n.o..u.IK.i.ba..r.ao.e..rbh...J.Ur.ri.n..wEF.rosl..ooF..n..a...f..y..yet.a..So.baNSSi.so.o.yt...e....Eso.a.n..shhl.Ka.....tEEde...s.nlEt.J..srg..A...eh.ltr.a.t.thePsarh...nuiD.nno.a...a.Etesm.ao.iult(Ru.B..n.s....ynnnm..lnserme.at.aNe.[...].y.erAJetei..rete.b..l.JgL.ao.aaaeroopew..aullem..a.atHM.M.riwre..Saa.r.u.eWa.sl.apnKdennSn.l.FpHmlg...rlmm.r.asCBWoi..a.M.fcwisoy..arcpmingys,gh.HrB..oerotg.cruAMuY.rrnR[...]t...i..y.r..Oim.t.rpr..ttn......s....r.reo.gtSog..a.u.n.oAmg.o..e.....o..h.A..i.....a............inp.)...rh.nr.gr.L....e.....O.rr..mc.y...r,...m.n.d...u....a.a...N.ee.....a....n.y..s..L....eee..........d.k..............y.r.n.i.po.....r.Uo....t.a..e....i.....d.s.arr...........Luaon..........M...[...].nr.t....r..............w....n....y..i.w.......di.a.rm............B.o.l.).........n...M..H......um...[...].....e....hn...........lg.r....o..'...............a.......r.......aE..i.....l.oa.......a.......t.......tvl.......m.............b..M.......[...]......u..h.Mbnfle.........o--.g..n...S.........d..a.D.......uh..P.a..l.C.......b.asGy.....l....oe...l.t.a........yb.il.P.....d....,e.v..e.W....).Baecla.r..[...]e.es..).D.M(.GHe.en.gh..rru.).VDete.i.,.naOA.n.hy.a.hsJ.hr.dnorei.,..B.tt.a..aa.ae.ere.e..anWis.eiseti.a.i.urad..nr.ik..envnJ.y.n..Svt.iutlnD...R(ra.Rtrl.Env.eiBmldeSe...a1t-o.e2E.yioiP.nRRaitPC..1rdoi.CSeJ.MeinloyMtrdoB.a.3r.dnn.onlMdnvGit.eh.ACiohi0oo.ahtda)MSbt.tc7S.no[...]ubbing editor ...................Denise Hunter G a ffe r..................................John Whitt[...]Anthony Bignall, Synopsis: A madcap, musical comedy-[...]Peter Kulesa, adventure where the flying super hero[...] |
| [...]netloernttitt.vdmhgmdddddddpmfkrtdifnoccdtiretgop.a.ehtgdgt.nitmgontidctdteotneoptcdne.tnctroamedptef[...]r....stt-ytcyiod......i.ati.cl.mecdp:r.Wtreop..m..a.....n.vnordpor.c..to...rys.to.pcerceddrcdpits.ooieo.f.eu....s.c.iy..sa.sr.a..nd.d....i..ssehuir.pos..W.Tr.o.r.At.....i.rh.a.f..p.iaato....t.i.rovh..iogaar.rruti..u.(...hsc..[...].l...irs....da.o..D........lfar..y....o.eda.gg.rr.a..nlooinr.e.nd...sr.i..r.i.c..e.c.....d..E.e.nn.y.[...]....ir...c....ye...e.ec......cn..eT....co.....att.a..(.kcs..atxi..nrl.t..o..........o.......iy..tt...[...]..s..r.t......g..c...o....as.uo.srrrkor).......t..a....m..t.r.n..(....n.........aH.n..........go.....[...]....m..............ontr..r...............i........a.W.o...ro.tt....e....................te...........y.L....g....te..................a....a...........u......................(b.......n......[...].......(.................r..r...........l.......f.a...Pr.........Ae......n............i....t.....p...r.......e......D...r...................W..a...a....i..........n...................o.............................a............k.....il...C.................n.....n..[...]d............R...............l.m..................a.a...........................................s......[...]..)....i..r.........................v..J..........a............a.r.....t........'................l....t...........[...]........).........wt...................rIf........a.....A.........y....e.S...........d.............................lU............,......v..........a...........a.............r...l...........i..o.....a.aa.......................................d......n...i.i.....n.....i..l......s...B...........e...e..n........a....m......t........v............t..l..o....m.....[...].o..h.ee..To.e.L..H.l.....e.G..M...i...Si.........a..m......he.t..e...AM..o.r......eI..a.o.Do.re..........ol.......i.....o..t.i..S.SaoB...[...]..K.......S..ye)r..fKtC.cy....e.l.....l.oa.HA.ian.a......oa..u............ei.us.t......n...svn.c..Ra.dPPDlh.as....e..,....a....luh.....ICbCGD.....ra...e....i.r.ieiEhl...JBP.M.iiw..u.aoJ..e..Lnmrndn...eil..i..f...a...arDt.l.g.c.oa.aaaDe..kwtrr..dJd.a.Se.n(.E..KMrem..g.e..a..Bref.no..n...YFDrrh...Jei.nru.i..da.a..Ja...o.o.nnlPdsoeA.hJnnoeio.Pnri..P.ic..hn.oh..c[...]oiaatomeotodntcdgadfttatsntageepntgtdtrapueudngdd.a,,,e,supu,,t,idt,orFpeaesuedt-tvcp-dimduidissaed:e[...]ttieetc.hmpcsordp.siMyiodstisieesitenmpet.....r/t/a.tceua.adosrleneutsasaddprepcddd.....mclobmcl.lotl[...]..tec..or...nti.t.gpl.....r....bi.r.e..o..aea...l.a...uooyo..srSy..rs.yk.eae.r.r......s..s......y.t...t.ors.....ttg..t...m..a...tn.......r....t.cn.....ah...oe.....r....a..a..nin.gog...oap.n.crrr.........oo..t........i....a.e...ra..v.....b..t..b......e..............s......[...]..i..................s..ir..........s.......t...r.a..........e.....................m...q....e........[...]...e..............t..............rs...t...........a..t..c.........C.............n.w....n.............[...]...................d................J.t...........a................i.....i........i.i................[...]...o...........................j....l.............a...............o..na................t.............[...]..l............l.................n.........u......a..................y.......................JD....er[...]................c...r......d...nt...........o.....a...M...............t.....b....G.....P.,....F.............o..a......en.........O..h.........CKE..nu..e...M....AW[...].e......BA......t....Pa....l..rrid..eST...M.He....a.AD..le..........i.Py.'....hn.......oreai.M.e..JMAB....c..B..n..aa..i..i.t...iM.....A.Bb..et.i.BS....a...a.tPPW.NJ..e.....yRalc..uis.o...da.in..n.ai.e....a.lU.nie..M....o..n.nJ.e.l..idEn.ee..Ml.mi.a.cS..ail..orm.MJoL.S.y...liC..WJCsITon...l.SGy.aa.[...]HWhaaeaeRrfPelyunuP.J..b.Sd.brhl.is.arors...nak.o.a,.e..oA.yne.PofzdiBue...ala.npyk.oAaaC-s.neP..aT..[...].i1d..noc.oa.srte..aacrm.arceyn/e..aosi.s.m.oB..r.a...s.assru.psr...n.eoar.c.-os...mtrn.l.a.l'...ri.......Alrr..o.o.i9d..nf.po.s..rortit.cepd[...].d....g.irM:sr....pp.e.ae.r.y..tro.sDJoy.dt.rp..z.a..e...yse.H.......po......u5d.dn..nue.o..attsohn.a....e.....arsreh...m.p.n..A..t.hsndr......rad...hra..s...rzh.....ao....ut..grA.........rn.t.da....oi...0.a..e.i.nd.uericT...eecv.n..d.m...e......Aart.....Gg.xyer.a.....tya.tu.s.s.l.i...n.ys.....e.....d.n.......e..[...].s.t....e.yoro..........er..no..t..et....al..r....a.o....Mwe.iy....y.l.Z.....nos.E.t......s....drlo.m..o......a...n..r..r.r.......s.ann.....t.....t...ry.......al.h...n..s.o..d...a.....r........n.......t.O.rio......o...........er.[...]....s.t......aln............n.....................a..r..i...e...e............S...ei..d.s.....D.......[...]....................or....m..................cC...a...i..h....ho.............h................B.............R.t...(...v...e..l....a...A.m.......l.........r..........A..............n..f...A...m..h...................iO........l.ee................el..............s....a.r......m..a....n..............R.....l...........l............[...]............i.t....m......--....W.i..c...m........A........s......f.......d.....Er.................t.[...]...l....t........oGR............e.................a.G...rin..e....S...a.......e..r..a...P.PPPPPPEP...r.......a....i..............d..e......A..G..M...e.............P.P....t.f..o.....a.........t.......r.............hi........a.a..n...b...k.......J...u.....r..........-S.eeeees.b.ee..a....F..........B.&..........ta..........................enN.F.a..e...FS..1a.....o......t.n.aL.LLA&..s...hl..............n..........t..O.ttt.tt...tt.as........L.G...r..i.o.....c.....A.............W.....s....heeet..eet..eei.9sn..a.......a.O.nf..d..yy.nP..y...ua..e.Sa..............w...r..[...]..e...t..f..D.......................T.rrr.m..i)ho.a..rreDrr.l..nnN.3.E.l....n.sd...g.W.n....bn.M...D............Rso..z....tn.z..r.r...,..a.......r...aO.....o...g...........r......CMa..m..CCeC..,lCe...a0CC.ae....e...a...aTk...k..d...ar......e.ao....i.o..sdo...Y....ea...CW.C....a..yo.i..g.C..n....r.....e..........eaGLLGG.s..l.E.[...]....nlo..uPf.u..iF.yyd...y.t....na.een.e.i....B...A......o.nnnd.r.irrnpn..nBVRBuMwiViVni..i.i.n.e...ec..tJdG.e...e.......g.l....ttngn..gnno..Cdtnn.eee....a.r..ot.ihl.gCg....Ac...........$.e.mnnnh..on.nr.n.[...]Bn.t.e.ee.Hg.LieteanS.gg.tng..o...Tn.ofddh.dTrFG..a.....i...ir...5hG$..r.T.iii9e.roti...iliie...g6hel[...]nnn..liell.nnnn.tioxa.C.u.uie.iR.l.eue.CadueeuehC.a..rn.h.c...un.8t..0.neJn.5.A.w.r'k.AAh..Drr30eBYnBnBn...5....uHuco.aaggoggsggg[...].rst.ste.irs.ietospm...tyrsry.ddunet.set.tae..iTl.a./.a..is.ernTi.dcceoefalsipdo-..o...n.i.trm.tee.e..aoi[...].isirr...e....n..ule...et.ss.e...y.ogor.tr.p.nrod.a..si..aeeeh.....pa.eouf..o.as.....e...tiB...h..s..[...].re......g...r....t..o.....es.t.c.r.ce.rr..n.v.t-.a..asu...g..sd.ayi.ea...a.ni..cM.cT..nrp.nt.mm....e....a.>e.....ta.c.la.rc.c...s....a.c..ryd.e.ic.............ch....i......td..y.rtr..t....i.r..-....in........a...ccn.epne.......ltt..yn.ndt..w..s.....n..as..ht.[...]e.o..ao...S...oi.......o..ao.......o...e.....se...a....hig.....h...rto.h.yr.......yst.e.o...1.t......[...].d.fn.n...ad......rr...s..n.....n........r.r.t....a.......r..rth...........Ety....e.ro.d.............[...]..............gt......o..........s.....s..........a....e........r.........s.....b...........e........[...]..........er......................o........e.o....a...o...i.........S.....fe..y................n.....[...].......................y..........................a......................wJno...........mn..-.....w.o[...].........................e........................a........a...m....................-..a...........f.h............................o.......[...].....n..t.........El..s..........v..............i.a...t..........3..........................e...h..pS[...]..............d.....i.h........b............kR....A.............M........l..........t................[...]..s....Le.........e.....e............T............a............o.p..r.........a....od..........l......B.......e..............t....u................a...yedr.....t....a.ioa.M....t.....o..S...o.....t......GS.C........a..h..............r.....f..........i...f..e.b....d.[...].....M............ao......k.en.............nr.y...a.n......a.......r.D...N..C............c......o.............e...a..................e...uc.oo.ae.(t.t..a...................r......t.......y......t...........e..dd....A.....d.dA.Ph.o.......h.....D....VM....i...e........s......a.n.KKh.t...Ba......a.t...o......lPPHS.r.r..rl..t....rE.tk.............[...]...v...e.r.PFi.....s...fi..e.ee...n...l.......D...a..ehh........h....n.....R.dan.......oFb..HC.......rr...aJ....a...M..i.M...e..iJl....h......e.....t...iKS.......TC...r..M.J....M...nhL..B.nn..nd.f.ae.....k..d...it........a..e.eB...aegl..r....l.BB..o.BhD..o..e.W.We.....c...d.loi.....i..l..e.wb.....i.a...h...y..c.....RGBV..e.ta.r......e...l.v...i.nngo[...].....J...R.....ar1rrn..e...n..KP.ohm.n..pJ.cie....a..c.t.b...yiieo..MTT..ae..et..ir..(...n....oBSiJ..(M...F.i.uln.e...B.k...o...ll..e.ih..eeri.o.-r.o.s.o.p...a9.....oe...pitll...--).dS.M.C..ll.TC...n..l....v.na...a..rl.g.....r.hl.eor.r.u.u.Ai...sy.ShlJ....h.M.A..y.dr.n.(...S.iyi.J.h....o.tn...ttc.n..in.p.u.d.h[...]e..t.ytn.o.m.ioe.ni.lr...tedB.Si.to..n..p.c...9h..a.harSC.d..hSS...o....iacSart.b.S.KcHi.pMoy.oh.me.W[...]h...e.m.meeaoaWiiosPtHKn.Prc.ll.hrG..eP.oiKroocuM.a..naKiMdd0JJGemhclJorguco.otTelieMecsir.Tei.-ini..[...]ctaeEo..e....os..........rnnn..enI..t..........b..a..heo...pw.....Ig..e.......e.ts.......o......R...S[...]y..........yy....s.yo.l.ieon......p....fhos.....g.a.e.....i.......r..r.n.....til..t....s..tC..o..........g......E..a.......n.t...fSta..uAa......k.oB.e.hpt.......t....[...].r.........r..........r.e...l.......nc.ip...m..t..A..r..de....ai....D..m.....i....T......tn......d.T.....e....sRt........e...a........r.....u......e.ha....cAa....t...r..iia....[...]...ei....e..u...C......C..La......s....w......oe..a..p.l.......e...ria..D....ae.p.ah..9...u..a.............l...U.........r..od.O.r.......t.e.i..[...]B......o.shI....t......1o3.snm..r.i..s....pn.l....a...s..m...i..........uo....M.C.s....d.se.........l.An.....a.......'.n.....li..o........90.C.lr.e..e..y..t....[...]..s......et..d......o.r....i...k...k....le..d..n..a....o.....n8.n..s.e..er.t.........i.........Aa.Sea....r....ol.a........V.aAn.a.......i..c......na....y..r....dT.oDSJ,..rf......2r.nl......C....r.......h......cl.....aa...r.ic.a..l....MdF..u...t....y.D..Ea....w.ti..s.Nloel......u.fl.............p.b..gsa.....o.A.....bi..i.imh.......nr...r.......wR......v..RH.c...mgnTao.r..a..vo...A...r.wVl......C.e.E.o..i.oy......o....pP..n..coiai.......wuda......to..ka........o.R.tdes..eCth.a.nBnABfr......ooh.......nh2s..v..o.ui...I.i.ir.h..[...]ila..n...sS.Pb.ob...soooOa.Mriin....l...ta.nsTT.."A.o.gTkRen.....)i.McsMBks.eJAn...v.Ypek..i..t...gu.[...]tnnnxo.E...rP.itsvho.ah.ti....ry....tnlFeo....aia.a-aODGa....awr.ol....uchs..b...a.vdoah.sA.s..ena.eohnol...CWpr.iCCIn.....reie.a...tl.odn....i.sr.ldr..ra.lthn..a.lAA...e.O..uchio.tils.a.bl..llo.sPnn.mw..ayl.sUtHrot.y..e..Hu.ec..myi.fe...oe..,ao...neA.iHnEinDei...a.o.O.tl.,iet.p.n...nnre,.1.nHbvnt5En....kShl..'lnn[...]D.agskLoeR..akM.To..dnMdwm....opi.dda5oear.TPp3uW1A.co..LiM'n9fw....Pm1uPnont.MM.ireSwt.ll.ryunhR1.ewu..OMleSeo.oEnleer.PlDnaeya6.reoir..anao21igret.l..a6.mowso.lrmd.h.rmebagm7ic6loi.n.iMas.Jonrraasuwf,m[...].......................... Kodak to be flooded by a government hydro-dam. Sonkila, Chris Haywood, Da[...]cs of the country and with Jill Bryant, Synopsis: A mystical journey through the JULIE JULIE Synopsis: A dramatized reconstruction of an English Embassy s[...]ert Cameron. the audience on a surreal adventure.[...] |
| A A T O N ... The Silent One [A lw a y s s e e n b u t n e v e r h e a rd ][...] |
| [...]developing a major television series to be Mechanic........[...]........................... Post-production Mixed a t...................[...].......................16mm A King of Shreds and Patches -- P.M.[...]gh Stuckey, Sue Woolfe; tele b y ......................................[...]...........................DavidJohAnsoGnrave for a Dolphin -- McElroy and |
| [...]R S W e have a well equipped sound departm ent[...]capacity and invite you to phone for details:--[...]S o u th A u s tra lia n F ilm C o r p o r a tio n KEM 800 SERIES: EVERYTHING IS POSSIBLE When you edit with KEM, |
| [...]) at Keith Connolly a dogsbody eagerness to please just Patricia'[...]dy from his ailing Paul Cox's Lonely Hearts is a neat mother to the local elderly citizens' bolic, but there is a little of Peter and compendium of attainable vir[...]Patricia, only child of an over p ro b a b ility th a t m akes the doubt appreciated this fact.[...]so telling. The two suffer various hesi A sad little social comedy with fusspot m[...]parents. with a nice mixture of artifice and somewhat implausibl[...]simplicity. in a recognizably commonplace milieu. Free fo[...]ating to them the next step: they nervously seek a Peter's interfering and bossy sister and or[...]Cox and Clarke concoct a small but ludes, not at all in keeping with its[...]easy for shoplifting, to resolve the couple's aren't as subversive of the whole as[...]dylike counterpart, totally against the grain of a lifetime of complaisance, accepts the lead role[...]e individuals are Peter Thomp son (Norman Kaye), a 50-year-old bachelor piano-tuner, and Patricia Curnow (Wendy Hughes), a shy, mousy, but younger, bank clerk. They meet through a grasping introduction service and the film charts the uneven course of a diffident romance. It is a less-than-novel subject, ripe for cari cature, but Cox, maintaining a basical ly humorous premise, invests it with wa[...]eering sister (Julia Blake) and others. There is a sugges[...] |
| [...]Mattel Affair], to mention two), a Southern Italian family. He is a protests of an other-directed Mr Nice humor of Lonely Hearts and even comes as a very positive surprise. teacher in a Naples reformatory for Guy. lends Peter's more antic behaviour a[...]i's films were approached by the police to find out Several of these incidents, such as made with a political perspective, which of the children have been the blind-piano-tuner episode and a The Best Film award aside, the sig[...]at night, " stealing or nervous assignation with a call-girl, nificance of Cox's achievement l[...]ni sulla citta doing something worse" , as a rattle about rather loosely in the narra his[...]tive structure, giving the impression edy, a genre all but ignored by Aus Mattei Affair (1972) and Lucky that a certain amount of post-produc trali[...] |
| [...]rker who does not feel much tears, accompanied by a discreet and yard. The camera follows Rocco from follow -- offer a ravishment to the sympathy for the establishment. As a almost silent sobbing, and it is Marta behind and[...]arguments tend to be very who asks him, " Why are you crying? head in the centre of the shot. Nicola, seems exciting. There is a quite emotional. Raffaele believes that it is I[...]ing his job that grandfather dries his tears with a hand appears at the upper right of Rocco's foliage, swollen streams and distant stops him from becoming a terrorist; kerchief saying, " I'm not crying, it'[...]es carry the what is going on. This was certainly a color photography, accompany the police find the troublemakers among coffin to the funeral, an[...]definitely scotch the possibility of their man. A close-up of this gesture -- his The acting also is superb, parti where Aeneas is to take up the position re-education,[...]ularly Charles Vanel's performance of manager. As a result, there is a pre concern. Raffaele faces a similar symbol of the seed of life -- conveys as[...]increasingly aware of the inertness at Rossa, a worker from Genoa, who was simple wisdom of an ol[...]symmetrical dreams of the three " He lent us all a sort of serenity. the heart of the narrative, so[...]ring filming he was like the stones was initially a visual excitement terrorists to the authorities:[...]ts itself in getting the Gunns to impossible for a crowd of witnesses himself going to bed with her.[...]leep while looking at the photo Three Brothers is a very special film dissipates its energy in a series of tab to be murdered." But Raffaele ack[...]talian directors who have not utterly to build to any sort of cumu gunned down in a bus in Rome, and managed to produce any recent work lative power or meaning. The screen[...]gaol window bars, in a colorful, sur same time, it is a montage of poss When the rough foreman McLennan[...]ho has spoken with about love: love for parents, a wife, New York's skyscrapers to Moscow's when put together, achieve a highly vigorous chauvinism about Jeannie's a little girl; love for nature, for one's Kremlin,[...]is cheered by the crowd of children, in Nocella, A ntonio Macri. Screenplay: does -- and becomes her[...]e film and is linked directly to the crucified in a crossbow (in which Pasqualino De Santis. Editor:[...]of the Christ is the arrow); Rocco sets fire to M a stro ia n n i. A rt d irecto r: A ndrea hinges, Jeannie will first express[...]ss reminiscences, his young wife loses her a rubbish pile, with a view of a canvas, recordist: Mario Bramonti. Cast: Phi[...]cola), Vittorio Mezzo dinner table will give place to the parallel to that of Marta playing[...]film. But this time old Donato Crazy" ). A Neapolitan, Daniele is one 35 mm. I l l mi[...]the house and give Jeannie a new sense own wedding ring.[...]d walk into the future. Third Son is credited as a source of Daniele sings: inspiration si[...]ions " In my life I want to live at least a As one of the few Australians alive[...]short story. The communal day like a lion Mrs Aeneas Gunn's[...]of open mind received was, in the main, a the term loosely -- the major narrative beside her grandfather in his bed, a popular uprising in 17th Century sumpt[...]loved tion of town-bred Jeannie's pluck as where his wife used to sleep. Naples ag[...]he rigors of outback Most effective of all is a dialogue[...]directorial ineptitude. he asks her, " Why are you crying?" The girl answers, still crying, " We ar[...]idealism, his Utopia of a clean world: a wo[...]money; a world of happiness.[...]t. Igor Auzins, the raised, carries any dramatic weight. In 1. It is im portant to note[...]mple but brilliantly- director, has opened on a close-up of fact, the word " relationship[...]the Red Brigade, and other extreme and hears a sound of sobbing coming gives way to a beautifully composed Jeannie, Angela Pu[...]st uneuphonious name obtaining sympathy from a few dissatis towards the kitchen window and, f[...]ees both his brothers in the This in turn cuts to a vast, empty, virtually nothing to the role except[...]nt'anni da peccora" (" It is better to sented in a fast forward-tracking shot, those of Gilda[...]live a day like a lion than a hundred[...]e state by the majority of the years like a sheep" ). as the camera hones[...]passes a figure on horseback, before sense of cla[...]n mi deve condanare These shots -- and a great many that If the role of Mrs Gunn is to mea[...]anything, it must suggest a moral 2. Interview with Rosi, Sight & S[...] |
| [...]asks only cliche responses of her and " you can't take her away from her[...]The stars are twinkling brightly in or by a sense of inner conviction, to attempt to lift this sporadic interest to the night sky. In a secluded clearing of geist1, Spielberg has reach[...]the level of drama as she tries to save a redwood forest on the outskirts of heart and[...]s, an alien spacecraft sits, memories and made a film that is both Dignam's intelligent brick-bui[...]dow. ronism, " Where did we go wrong?" encircling the craft[...]brown fingers gently uproot a small the lost animal, the stranger from a awareness is most clearly seen in its plant, while a rabbit looks on strange land, the secr[...](Tony one spitefully inclined, the other a to the rim of the valley and gazes in must aid in any way they can, just as Barry) before the final st[...]ising, underlying strength. Jeannie is warned, " You must never misses its chances in the a[...]e Gertie must defy adult authority, take to be a mate to him" , but the prom potential[...]of course worn down and it lacks even a good ear for a beings watch in stunned amazemen[...] |
| [...]or some it will be deceptively simple plot in a film which tradition largely ignored since the people would deal with it. In Polter a new experience after having been eschews narrative progression for a revival of the industry a decade ago. In geist he set a graveyard of ghosts onto bombarded by mindles[...]ng metallic surfaces, well on occasions as a thriller. An would have to be a hard heart indeed assorted machines, cars[...]nces. Ballinger persuades Jane (Kim with a UFO while on the job; the for E.T. as[...]t the film. during his absence and attach a bug to[...]monitors that cover the entrance to Island; and a man quietly travelling the high exhilaration. You will be glad that narrative would head in thi[...]dis country roads of the Midwest is a film can move you so. Egerton would cut to the[...]acted and the killer arrives home to attacked by a maniac driving a computer. find Jane trapped inside with the dis decomposing tan[...]fantastic occurrences The Extraterrestrial, a film that is vir The plot is concerned wit[...]ral because the tually the cinema ideal; a film that machinations of an anonymous co[...]ches the audience, not with ment in a sensory computer, the 1-500, The important[...]ielberg. Producers: Steven project. When a car accident confines effect. The pity is th[...]ielberg, Kathleen Kennedy. Screenplay: him to a wheelchair he loses interest in tion with surface imagery and the method of lighting -- where, for the Melissa Mathison. Director of pho[...]n Daviau. Editor: Carol Little his attention to a murder in a nearby tion of machine over man allows this[...]sic: John Williams. Sound: Gene Can- begins a cat-and-mouse game between ence involvemen[...]Thomas (Elliott), Peter Coyote (Keys), as ever), and Ballinger. It is always a somewhat presump Star Wars veteran Dennis Muren[...]The early scenes in the film establish that a film incorporate neglected creation of suburbia invaded by a Sean Frye (Steve), Tom Howell (Tyler),[...]rl), David O 'Dell obsession with his computer. A pre pointing to a number of missed oppor[...]aracter detail. which the main star has not been a U.S. 1982. a video hook-up in the house, person or an animal[...]counters, Scenario: the hero, confined to a argument also reveals the strain that[...]nstruct E.T. after wheelchair, discovers that a man, in an Ballinger's preoccupation with h[...]they are regarded as actants rather with a loss of $700,000. The creature self, has mu[...]: the crippled, intelli that Rambaldi devised is a fantastically becomes aware that our hero know[...]e understanding wife; the complicated being with a rubber/poly- the crime, although nobody wil[...]ry corporation head; etc. urethane skin covering a steel and isn't -- at least not in the h[...]ng. within the framework of the drama to needed a dozen operators to handle via writers Linda[...]The computer detects the crime, and create a number of tensions between[...]d by the film. E.T., at first, is something only a mother could love, and that is indeed[...]It is pleasing to find an Australian true. Soon after Elliott lured E.[...]film that acknowledges a narrative his room and could be seen clearly fo[...]time, standing quietly in the corner wrapped in a blanket, I heard a young voice behind me in the theatre whisper, " Isn't he beautiful." When a filmmaker can imbue a pile of rubber, wires and servo-motors with t[...]T. forgotten. One recalls the loss of a pet watch. No sequence, scene or Marlon Brando and with a lot more personality). |
| [...]ssary for plot progression is Stollier, who has a predilection for leather and bondage. Without kn[...]stylish film to look at and listen to. There are a number of striking visual sequences which readi[...]leading up to the murder of Stollier's wife are a prime example: the carefully- composed image of[...]Production designer: Larry Mexicans got a saying -- what cannot course, Michael Cimin[...]. recordist: John Phillips. Cast: Gary Day " You haven't got enough ass in your the frontier[...]Production between the leads -- " I've killed a the Ugly American. A generation has photography Ian Baker and c[...]uctions. Dis man" , " That ain't no kind of a recom grown up unable to understand that[...]barosa keeping you entertained." music give a lift to their scenes. There[...]ebunk the is no question that Barbarosa is a Barrie Pattison[...]oo is seduced by Fred Schepisi's Barbarosa is a language convincing on film and Bar[...]eople Barbarosa as part of its maker's area, where the U.S. army was based verbal set pieces. A local bandido tries were taking John Ford's Man[...]Libido, carried conviction. A naivety, much modified decors for The Alamo.[...]which suggested that the death of a Native Texans Willie Nelson and Gary fac[...]cking than des Busey lead the cast as Barbarosa, a has shot. The villagers compose[...]touching nerves. It had the community, and Karl, a German[...]he words for Karl, who is familiar with a variety of these exciting tudes, a quality that outweighs any In the opening scenes, the teaming impatient till he finds a part of the set pieces: e.g., Don Braulio's[...]n, say, Craig's Wife, up seems uneasy: Nelson as a grubby,[...], on the other hand, an established together for a while, however, they wife, Josephina (Is[...]country's most respectable good cause each with a likeable sense of humor.[...]again they are stands apparently unperturbed as a[...]Mexican's bullet creases his cheek is a nice flourish. Once again,' one American states knows, there are a shifty and whoring, a representation (great effect that, too). It is not until hears a different version much'later. host of region[...]Both end with Barbarosa blowing with a couple of Hollywood stars and a with that in films from the Mexican tutor Karl in the business of being a[...]knee stylish and entertaining gloss, which a man more nervous than to see a man with a shotgun. have sunk wit[...]Hearst's disputes with the Mexican like a spotted ass ape." The film[...]e one who tells Tom Mix, conspicuous features in a script by co The use of close-up insets is[...]red Schepisi who moved to am going to keel you" ; Chris Pin wrote 10 years ago. Since then Witt[...]e script of The Black forces his way, with a jingle drop of[...]Mind you, Schepisi is not the first of[...]the home washing, flut and come back with a feature. That[...]Why then did a well-made, enter whose professionally nas[...]taining film pitched at a popular[...] |
| [...]calling provides a bridge to these ally. They have yet to find a film which complex film, which reveals a web of spirits and is a form of communica Taiwanese cop more flak in fil[...]tion. Lacking a lobby as effective as the Barbarosa: Directed by: Fred Schepisi. physical worlds of the people, and a This aspect of the magic is[...]a -- paddling out to meet the decade, apart from a few minor items Busey (Karl), Gilbert Rolan[...]ce of prow of the boat, at close range, with a[...]shark-calling in the context of a belief camera that is amazingly steady, even[...]pattern and its rituals. It is more than a shark caught in his hoop, clubs it and et al. It does, however, emphasize a In The Sharkcallers of Kontu, method of catching fish: it is a form of brings it into the canoe. They have a problem very evident in the Australian Denni[...]c and de-dramatizes magic, an expression of a relationship fluous commentary.[...]it to focus on the spiritual meaning with a spiritual world and with the to subsidy) of comm[...]ted them to respond only to the trusive way: a very low-key narration pressure.[...]its the pressures of change. The result is a calling of the shark-catchers, who had he[...]ave some spiritual force Later, there are a few instances of with Don Braulio. There is the[...]t in this narration. In notion of the pursuit as a crusade[...]knowing that the person behind the you Luis Bu |
| [...]A Midsummer Night's Sex Comedy the dramatics of[...]brought about by the imposition of A Midsummer Night's Sex The f[...]rehension about why other values are, in a sense, didactic Comedy[...]`counter-magic' of a church service, or turned to fairy-floss. In A Midsummer liberated and a woman of the future; |
| [...]by Simon Wincer, fo r producer John Sexton, from a screenplay by David Williamson. Clockwisefrom top: Tommy Woodcock (Tom Burlinson) rides Phar Lap during a morning |
| [...]omissions, almost inevitable in such a Marketplace 1982-[...]Corporation/Film Victoria? It is a reviewed in Variety from January 1,[...]Next is a complete listing of all the[...]1980, including quite a few Australian Hardback, 814 pp., A$45 programs, from A Big Country to I[...]final section is simply an inter Young Ramsay; a list of all the Emmy[...]Shot J.R.?); all A Screen International makers an[...]ency, Monahan Dayman of Patrick White's A Cheery Soul to G.[...]siness paper, Variety, has been on. It is a seemingly arbitrary from the beginning[...]latest venture. It is divided into three a valuable handbook. The price, given nominees[...]stantial sections. The first, " The that it is a paperback, is prohibitive. 1958 to 1979, as we[...]to 1980; and, of a little more than 100 countries. The two o[...]ubject to current biographies at the outset, a another alphabeti[...]datingly so. In a sense, it is a commem this book -- no, monumental tome --[...]The Australian entries are fairly versary, a distillation from the back simply, it is an[...]files of what is claimed to be " the for any library resource centre con[...]st single source of information nected with any branch of show without saying that it is not a patch on about the entertainment industry[...]There are mis-spellings, than " to provide a single source of Variety's third recent[...]rs, actresses, hand, this latter work has a massive[...]singers, songwriters and writers ever[...] |
| [...]A&R/Angus and Robertson, $12.95 reference books or[...]e Australian obviously not so. It is, in fact, a fas c[...]erica's Favourite Movies: Behind the Scenes A&R/Angus and Robertson, $14.95 (TPB)[...]Featuring more than 200 careers, each being o f a vision Yearbook is basically an veter[...]lm- The Best Movie Trivia and Quiz Book Ever A&R/Angus and Robertson, $14.95 (TPB)[...]'70s. Illustrated. drive units" ; then follows a separate The Best TV Trivia and Quiz Book Ever " Film technicians" section that, in Bu[...]much rhyme or reason: Tony Ginnane, A nostalgic look at American television.[...]e " Technicians diary grounds? And it is a pity that the A great collection of facts, figures and anecdotes H ollywood's Children booking service" . This seemingly ever- entries could not be more up-to-date:[...]trades and industries in tunate lag of a year or so.[...] |
| [...]th Taylor -- The Last Star A well-illustrated career coverage.[...]and Stoughton, $5.95 Monroe: A Life in Pictures (HC)[...]uthoritative study o f the controversial A Pictorial H istory o f the Talkies screen's most publicized actress -- a most detailed Sigdwick/Hutchinson Group Aust[...]hy. A pictorial tribute to Marilyn Monroe, mostly in[...]black and white and with a section o f color photo Repulsion (The Life and[...]A year-by-year, fully-illustrated coverage of the[...]year's films and top stars -- a new and revised Ruth Waterbury and Gene Arleri[...]Coronet/Hodder and Stoughton, $4.95 A sensational biography o f Liz Taylor.[...]erback. Western Films -- A Complete Guide[...]ms o f Charles Bronson A new paperback edition of `long' interviews with[...]A guide to the Westerns screened in the U.S. since[...]a the advent o f talking pictures. A title in the popular " Citadel" series. New in P.S. I Love You: Peter Sellers 1925-1980 Essays by Ma[...]tana/William Collins, $4.95 A collection o f articles, some previously unpub[...]onda -- His Life and Work A biography of Peter Sellers by his son, assisted[...]me of the Brechtian aspects of The Blood o f a P oet/T he Testament o f Orpheus Norm Goldstein[...]lson Aust., $4.95 (TPB) paperback. A well-illustrated and comprehensive large format[...]Television Monograph -- Coronation Street A well-illustrated coverage o f Bogart's careers.[...]A large format illustrated biography with a Seven years o f film reviewing -- a critical view of BFI/Gaumont, $8.75 Iron Eyes -- M y Life as a H ollywood Indian complete filmograph[...]s of the 1970s by Kubrick, Huston, Hawks, A critical view o f television drama through a Iron Eyes Cody as told to Colin Perry[...]PB) Jack Tinker James Dean -- A Portrait[...]Talking A bou t Films The s[...]lished photographer. A biography of C. Aubrey Smith, English A discussion on Indian films and various aspects Television Monograph 12 -- WDR a n d Rhe[...]he cinema in general. A'rbeiterfilm: Fassbinder, Ziewer and Others The[...]A discussion of documentary films made for West A series o f photographs o f Marilyn Monroe,[...]life and presents a vivid insider's view of film- RKCP/Cambridge U[...]ing, told with humor and honesty. A critical history o f the origin and development o[...]A History o f Narrative Film[...](TPB) An illustrated biography o f Chaplin with a Godard: Images, Sounds, Politics David A. Cook Cov[...]iana University Press/Imp., $16.70 A comprehensive history o f the cinema designed L[...]Conceived and designed by David Lyons A Hollywood story -- the autobiography of[...]ay, and the message of Graphis Annual -- a presentation of the adver days, and later. A revised edition of this book originally published[...]films made by Hawks and it includes a new The Pictures That Moved[...]A pictorial history of Australian cinema from[...]A picture book for young readers of the film[...]st., $25.00 We o f the Never Never A well-illustrated, in color and black and white, A survey of the work of political filmmaker,[...]creen Greats Kubrick: Inside a Film A rtist's Maze A new edition of the Australian classic novel, now[...]orial History o f the Silent Screen a major film. Wattle/Gordon and Gotch Distributo[...]A critical guide to the films of Stanley Kub[...] |
| [...]SWAN STUDIOS AUSTRAUA A IMOIM-PROFIT ORGANISATION AIMED AT[...] |
| [...]pecial Effects Make-Up forthe Industry. -- R.C.M.A.(U.s.a.) VISIORA(France) KRYOLAN(Germany) On locatio[...]ghting. Taxi Trucks 11a Leichhardt Street Designed for HMI[...]Contact: |
| [...]like that. present a point of view that may be[...]can help you to understand certain[...]or games of a director; it is like th[...]ing others; for me, a film or a play rubble because of the incredibly[...]ce bread, always has a significance. high cost.[...]F ilm ograph y You have to make certain[...]don't save us from atom bombs choices; you have a measure for[...]1961 Incontro notturno* giving an impression of a given[...]things. But they are a prime mover you can spend. We don't have all[...]Short films produced for a diploma those millions for making a film[...]1963 Storia del III Reich Are you one who is compelled to[...]A documentary for Italian television. impart a message?[...] |
| [...]ward's story in response to her attorney's (not a " technicolour blockbuster" as Anderson[...]wrongly claims, but a modestly charming rural[...]Ray's The Lusty Men. But whatever the role, " If you can't say something nice about a though more explicit in some details than '40s[...]lowed. worked like a dog to give it conviction. dating Joan Collins t[...]arker but discovered in bed means perhaps a dozen of the 60-odd films she[...]emerges from Anderson's Dorothy Lamour's was not a major career biography earning our respect -- res[...]was GREGORY PECK, who, but it provided a good deal of innocent is, for the way she worked[...]iwithout ever being especially pleasure. To give her -- or Mr[...]interesting, has remained a star in her films. She has either a good memory or handed, and for an unillusioned ap[...]figure so many of the less lurid roles but I have a special affection for he appeared in two and in[...]studio, about the films, even if this remains on a pretty wavering between admirers (not at all a received much more rapid exposure (e.[...]iety of roles early marriage to Herbie Kaye, was a model of her), in Jacques Tourneur's beautiful western pushed at them gave them a chance to find their[...]ssion of being very most beautiful man [she] had ever seen, in or carefully moulded around a limited range of[...]Peck is a star of the same kind as John A nice girl" is probably not the[...]same calibre. Like them, he is essentially a tells her story (published by t[...]With Peck, what you get is what you see. way of drama), she was a real fighter -- tough,[...]Michael Freedland's biography posits a real-life demanding, humourless, loving sparely[...]usual screen persona of a liberal American -- struggle with cancer. When[...]and the resulting book is a bit dull, like its her doctor marvelled, " Nothi[...]but he can't help sounding rather a pill from like it" (p. 258).[...]" Stop knocking everything -- It sounds like any number of the characters[...]and's book not wisely but too well" -- there was a lot of[...]with a few exceptions like A Gentleman's (1949); Jane Froman, overcoming disa[...]e Gunfighter, Twelve O'Clock entertain troops in a walking machine, in With High and To Kill a Mockingbird. Those are all a Song in My Heart (1952); beating the booze[...]ned to play bottle! Filmed on location -- inside a woman's[...]but his is scarcely a comic performance, and in Graham, perhaps wrongl[...]e she was now -- had been since the late 1940s --a true star and was now unimaginable as anything[...]that had hitherto eluded her. It eluded her in a big way during her marriage to minor actor Jess Barker, a stormy liaison even mainly out of her professional superiority and leading to a scandalous and acrimonious 580 -- D ece[...] |
| [...]stardom in Stevens' A Place in the Sun (1951). Lewt in Duel in the Sun, fo[...]f Kingdom -- but somehow it is all suffused in a[...]in The and this adequately written account by a[...]unappetizing life-story to a halt with Robert[...]husbands, Vittorio Gassman. A threatening Gregory Peck, but her real stardom belo[...]unworthy account of (half of) a lively career? the '50s -- that is, give or ta[...]none of her star-studded (if you'll excuse the like a star; she seems not quite able to take[...]hips is relentlessly vulgar, each new adven As a teenager, from National Velvet (1945),[...]ture cutting at the crucial moment to " A fire through adolescent fluff like Cynthia (19[...]roaring in the fireplace, Waves pounding a and A Date with Judy (1948) to Father of the[...]love-of-life, she reveals a shoddy set of values The apotheosis of her bea[...]ging coarseness. Her ego Stevens' still moving A Place in the Sun (1951).[...]where the high spots were (A Double Life, A beauty that would bring all a man ever Place in the Sun), but the telling is so riddled dre[...]about what took place in which year . . ." : this gomery Clift] would kill for a place in the sun[...]mistakes that derive from a lazy failure to check Stevens, that is, seems[...]from a wilful blurring of time in her first 20 taking[...]how she was " about 21" when she made A Kelley has a sure grasp of the high-spots of Kelley's book is subtitled " The Last Star" . Place in the Sun (" about 21" in the sense, that 146). She became, in fact, a bore about her mixed reviews. At the end of Kelle[...]she " often asked [Stanley] Donen why he based on a certain likeability and survivorship. American Tr[...]e directed" ; she claims she co-starred in The find: apart from a certain generosity and cheery seems really foul-m[...]n Monroe and hopeful about them, even[...]st published memoirs I have climate better. After a brief starlethood at know that at any given moment in life one has |
| [...]Maloney, M.L.A. (born 1854, died c. 1940) gives his ([...]atler newsreels have accompanied by a rolling caption written by Thring, One Ac[...] |
| [...]A M id s u m m e r N i g h t 's S e x C o m e d y[...]Lou Vernon -- " That's My Idea Of A Lady" (short 17) Stage Shows Produced by[...](3) Now You're Talking (Film Australia, 1978) Compila Efftee[...]tions. C ollit's Inn (1933) -- also planned as a film Non-stop Vari[...]" Ting A Ling And His Rattling Good Din-copaters" ) (short[...]Paper Film Reviews[...]of love" ; about previous films into a situation of sub Perhaps one of[...]Hopefully, having got A Mid |
| [...]V There's a new boy on the block ;[...] |
| [...]elp its release begging and grovelling for a trying.[...](which they have so For which projects have you understood from the very start that The d[...]approached the funding bodies? we were making a film and that Jury Prize at the 1982 Aus[...]s through their Lib John Ruane and I have a script inaction, was an act of interpreta i[...]I also received in rary, even to the level of a quarter that is currently in the first-draft tion. the mail a standard letter from the of the hire the same films were stage, Trial By Order, about a A F I's V incent L ibrary. It achieving while they were in the mass murderer and a boy who gets I was really quite worried about[...]g the past couple of years. What films have you in prepara of the Creative Development that your face is a mirror of every This is despite the fact that[...]Branch of the Australian Film thing you have been through, but organization helped[...]Commission said that he would how terrifying a face you would Melbourne Co-op out of existence,[...]for assessment have to have to reflect all that you taking over the films from the Co stages[...]The AFI then proceeded to One is a feature film script, Have you that word for word? seemed to understand it, as[...]which I wrote with beyond him and being as much a had been getting from the same J[...]t the Co-op and autocrati though we haven't any actors for " Dear Peter, the faces we[...]accepted for assessment by the Why did you reject the idea of further promote our f[...]FI has admitted its The fourth script is a very been presented in screenplay Ca[...]arde plot which moves all to accept such a project as a intercut into that story. It would your films to any reasonable level over the place, and characters who viable competitor for[...]oked like comic relief. The of hiring, would you please take change roles all the time. The[...]it is a crime and that he is searching known in advance of your inten you some money to promote This has had a very serious for an answer to his guilt.[...]ly I would have been "Journey" . What plans have you effect on me and, I am sure, upon able to warn you of the for it? m[...]" Congratulations on your has not offered any reasonable tion which is set up for, owes its Catherine Dalton, which gives a successes at this year's Mel season a[...]Bogle and Chandler, and Holt and won a special award on opening Hawthorn Town Hall and[...]in promoting Calwell era. I would like to do a night for Journey to the End of film th[...]xhibitor, prefers to show overseas rather than a film specifically " Yours sincerely,[...]as in far greater about Bogle and Chandler, or a " Murray Brown, dialogue, I feel we[...]lms. film about the book. It would be a " Creative Development Branch, and find another way of showing[...]ey are not the only ones who Pat Longmore has a plan to dis me the Jury Award, I am also[...]have reacted to it like that. It is a tribute the film throughout Aus[...]gruesome story, but how can you tralia basing the marketing on the[...]make a film about a mass network of RSL clubs and other[...]anything that deviates from a very[...]mould. not have to be a loss to the film maker or production company,[...]| Filmography (all 16mm) unless you get yourself into the hands of the conventional[...]Shall Rise Again 13 mins butors and exhibitors, where for[...]1971 Flux 40 mins hire through Cineaction to any 1971 Journey to a Broken Heart 50 mins interested organizations, s[...]1972 A Woman of Our Time 28 mins, col. clubs or college[...]75 Struttin' the Mutton 17 mins, col. would make a wonderful special[...]1976 Here's To You Mr Robinson co feature for Anzac Day.[...] |
| [...]8 WALKER o A&J Casting Agency[...] |
| Igor A u zin s[...]oratory. Berserk, he teaches by pulling a gun on the soldier at the end of Apocalypse Now.[...]nt graffiti on cars and then correctly. This gets a laugh from the audience so not depend merely on s[...]- context of the film but rather on the standards a[...]lly violent and murderous. They are pre help when you can, stay strong in attitude even end of the dram[...]ted, take stances and, when all goes occurring in a set of circumstances which deter made to feel th[...]ctions on how the film works they had in mind for you. make one realize that, if taken at too realistic a In fact, the film is not advocating either possi There is a long tradition of stylized, `myth level, the fil[...]ultimately not an answer; indicate the crises of a society and its ability or genre films do, throu[...]level of eruption purges us of terror, anger, and a religious interpretation of fate, guilt and[...]o responsibility. Shakespearian tragedies reflect a myth. be massacred by a teacher who sees Class of belief in order in the[...]d in poetic lass of 1984 may be seen as a contrived 1984 -- even though there might have been a justice. But Shakespeare also had his Titus city are a `not-yet' world like that of A Clock sensibility.[...]om New York. The school itself is an of an eye in a training film for ophthalmic its `shadow': the po[...]the bopper Grease schools; the surgeons is valid. A raven pecking an eye in a easy to ignore and gloss over for respectability'[...]ene for its own sake (leaving ing to know one has a sense of frustration and[...]t -- as in the western, the follow) or as part of a cumulative effect. One those whose life is, to a large extent, based on |
| [...]es for tripods and camera support any situation and period. equipment[...]W e are also able to offer a complete range of vehicles for R.E. MILLE[...] |
| FU JI IN TR O D UCES A V E R Y BR IGHT ID EA.[...] |
| ideal world you would . Ranl&HIm L ab oratori[...] |
MD | |
| The author retains Copyright of this material. You may download one copy of this item for the purpos[...]earch or study. The University does not authorise you to copy, communicate or otherwise make available electronically to any other person this material. |
Cinema Papers Pty Ltd, Richmond, Cinema Papers no. 41 December 1982 (December 1982). University of Wollongong Archives, accessed 24/03/2025, https://archivesonline.uow.edu.au/nodes/view/5051
